Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15200 199 / 9e-67 Ribosomal protein S4 (.1.2) AT5G39850 199 / 2e-66 Ribosomal protein S4 (.1) ATCG00380 41 / 4e-05 ATCG00380.1, RPS4 chloroplast ribosomal protein S4 (.1) AT5G15750 38 / 0.0004 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G209700 [exp] 216 / 4e-73 AT5G39850 325 / 6e-115 Ribosomal protein S4 (.1) Potri.018G062300 [exp] 216 / 5e-73 AT5G39850 332 / 1e-117 Ribosomal protein S4 (.1) Potri.016G076500 [exp] 211 / 4e-71 AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1) Potri.016G076800 [exp] 211 / 4e-71 AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1) Potri.007G056100 [exp] 198 / 4e-66 AT5G39850 337 / 1e-119 Ribosomal protein S4 (.1) Potri.011G094500 [exp] 196 / 2e-65 AT5G39850 336 / 3e-119 Ribosomal protein S4 (.1) Potri.017G101200 [exp] 44 / 2e-06 AT5G15750 291 / 6e-102 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1) Potri.013G163300 [exp] 44 / 3e-06 ATCG00380 358 / 6e-128 chloroplast ribosomal protein S4 (.1) Potri.004G113600 [exp] 41 / 5e-05 AT5G15750 312 / 3e-110 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008624 [exp] 195 / 5e-65 AT5G15200 342 / 8e-122 Ribosomal protein S4 (.1.2) Lus10012839 [exp] 186 / 2e-61 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2) Lus10030487 [exp] 186 / 2e-61 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2) Lus10042193 [exp] 196 / 3e-60 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1) Lus10001767 [exp] 42 / 1e-05 AT5G15750 317 / 3e-112 Alpha-L RNA-binding motif/Ribosomal protein S4 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0492 [poplar] [flax] S4 PF01479 [poplar] [flax] S4 S4 domain
Representative CDS sequence Show only first row Show all	>Potri.006G209801.2 pacid=42769871 polypeptide=Potri.006G209801.2.p locus=Potri.006G209801 ID=Potri.006G209801.2.v4.1 annot-version=v4.1 ATGAATAGGTATGGGCTTTTGGAAGAGAGCCAGAACAAGCTCGATTATGTGTTGGCTCTCACCGTGGAAAACTTTCTCGAGCGCCGCCTCCAGACTCTTG TTTTCAAGGCTGGTATGGCTAAGTCCATCCACCATGCCAGAGTGCTCATCAAACAGAGGCACATTAGGGTTGGGAGGCAGGTGGTCAATATTCCATCCTT CATGGTGAGAGTTGACTCGCAGAAGCACATTGATTTCTCACTCACGAGCCCCTTTGGCGGTGGACGCCCTGGTAGAGTGAAGCGAAAGAACCAGAAGGCT GCTTCCATGAAGGCTGCTGGTGGAGATGGAGATGAAGAGGATGAAGAATGA
AA sequence Show only first row Show all	>Potri.006G209801.2 pacid=42769871 polypeptide=Potri.006G209801.2.p locus=Potri.006G209801 ID=Potri.006G209801.2.v4.1 annot-version=v4.1 MNRYGLLEESQNKLDYVLALTVENFLERRLQTLVFKAGMAKSIHHARVLIKQRHIRVGRQVVNIPSFMVRVDSQKHIDFSLTSPFGGGRPGRVKRKNQKA ASMKAAGGDGDEEDEE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G15200			Ribosomal protein S4 (.1.2)		Potri.006G209801 [exp]	0	1
AT2G35790			unknown protein		Potri.010G219000 [exp]	4.47	0.9387
AT2G42740		RPL16A	ribosomal protein large subuni...		Potri.002G109701 [exp]	5.19	0.9290
AT2G09990			Ribosomal protein S5 domain 2-...		Potri.001G304700 [exp]	10.00	0.9426	RPS16.3
AT5G39740		OLI7, RPL5B	OLIGOCELLULA 7, ribosomal prot...		Potri.019G099000 [exp]	10.39	0.9410
AT3G05560			Ribosomal L22e protein family ...		Potri.010G012700 [exp]	11.66	0.9299	RPL22.5
AT4G00100		PFL2, ATRPS13A	POINTED FIRST LEAF 2, ribosoma...		Potri.012G128600 [exp]	12.48	0.9403	Pt-RPS13.2
AT3G53740			Ribosomal protein L36e family ...		Potri.011G066000 [exp]	12.68	0.9312
AT5G05210			Surfeit locus protein 6 (.1.2)		Potri.008G173300 [exp]	23.45	0.8988
AT5G56670			Ribosomal protein S30 family p...		Potri.012G086600 [exp]	26.19	0.8997	RPS30.2
AT2G37190			Ribosomal protein L11 family p...		Potri.018G145504 [exp]	26.49	0.9199

Compare expression of checked genes

Potri.006G209801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.