Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39850 130 / 3e-40 Ribosomal protein S4 (.1) AT5G15200 127 / 2e-39 Ribosomal protein S4 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G062300 [exp] 145 / 5e-46 AT5G39850 332 / 1e-117 Ribosomal protein S4 (.1) Potri.016G076500 [exp] 143 / 3e-45 AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1) Potri.016G076800 [exp] 143 / 3e-45 AT5G39850 350 / 1e-124 Ribosomal protein S4 (.1) Potri.007G056100 [exp] 142 / 8e-45 AT5G39850 337 / 1e-119 Ribosomal protein S4 (.1) Potri.011G094500 [exp] 140 / 3e-44 AT5G39850 336 / 3e-119 Ribosomal protein S4 (.1) Potri.006G209700 [exp] 136 / 2e-42 AT5G39850 325 / 6e-115 Ribosomal protein S4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008624 [exp] 141 / 2e-44 AT5G15200 342 / 8e-122 Ribosomal protein S4 (.1.2) Lus10012839 [exp] 138 / 3e-43 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2) Lus10030487 [exp] 138 / 3e-43 AT5G15200 333 / 4e-118 Ribosomal protein S4 (.1.2) Lus10042193 [exp] 119 / 3e-33 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0492 [poplar] [flax] S4 PF00163 [poplar] [flax] Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.006G209900.1 pacid=42768990 polypeptide=Potri.006G209900.1.p locus=Potri.006G209900 ID=Potri.006G209900.1.v4.1 annot-version=v4.1 ATGGTGCACGTCTCCTTTTACCGAAACTATGGGAAAAATTTTAAGAAGCCAAGGCGTCCTTATGAGAAGGAACGTTTGGATGTCGAGCTGAAGCTTGTTG GAGAGTATGGGCTCCGTGCCAAGAGGGAACTCTGGAGGGTTCAGTATGCACTGAGTCGTATTCGTAATGCTGCCAGAATGCTTCTCACCCTTGATGAGAA GAACCAACGCAGTATTTTTTAG
AA sequence Show only first row Show all	>Potri.006G209900.1 pacid=42768990 polypeptide=Potri.006G209900.1.p locus=Potri.006G209900 ID=Potri.006G209900.1.v4.1 annot-version=v4.1 MVHVSFYRNYGKNFKKPRRPYEKERLDVELKLVGEYGLRAKRELWRVQYALSRIRNAARMLLTLDEKNQRSIF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G39850			Ribosomal protein S4 (.1)		Potri.006G209900 [exp]	0	1
AT5G61840		GUT1, IRX10-L	Exostosin family protein (.1)		Potri.015G107200 [exp]	3.46	0.9276
AT1G14320		RPL10A, RPL10, ...	SUPPRESSOR OF ACAULIS 52, ribo...		Potri.013G159301 [exp]	3.46	0.9329
					Potri.011G073216 [exp]	6.32	0.9224
AT5G51600		ATMAP65-3, PLE	PLEIADE, ARABIDOPSIS THALIANA ...		Potri.005G057150 [exp]	8.36	0.9001
AT5G35530			Ribosomal protein S3 family pr...		Potri.015G071700 [exp]	12.32	0.9185
AT5G17050		UGT78D2	UDP-glucosyl transferase 78D2 ...		Potri.009G078400 [exp]	14.83	0.8163	UF3.3
AT4G17260			Lactate/malate dehydrogenase f...		Potri.003G111201 [exp]	17.08	0.8601
					Potri.001G108450 [exp]	17.54	0.8807
AT1G62440		LRX2	leucine-rich repeat/extensin 2...		Potri.018G151000 [exp]	21.00	0.8860
AT5G66680		DGL1	DEFECTIVE GLYCOSYLATION, dolic...		Potri.004G157900 [exp]	22.13	0.8776

Compare expression of checked genes

Potri.006G209900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.