Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36210 130 / 3e-40 SAUR-like auxin-responsive protein family (.1) AT5G20810 76 / 4e-18 SAUR-like auxin-responsive protein family (.1.2) AT3G43120 74 / 9e-18 SAUR-like auxin-responsive protein family (.1) AT3G51200 72 / 3e-17 SAUR-like auxin-responsive protein family (.1) AT5G66260 68 / 5e-16 SAUR-like auxin-responsive protein family (.1) AT2G24400 69 / 1e-15 SAUR-like auxin-responsive protein family (.1) AT4G34760 67 / 2e-15 SAUR-like auxin-responsive protein family (.1) AT2G21220 66 / 4e-15 SAUR-like auxin-responsive protein family (.1) AT4G31320 68 / 5e-15 SAUR-like auxin-responsive protein family (.1) AT2G37030 66 / 7e-15 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G137200 [exp] 75 / 1e-17 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2) Potri.008G037900 [exp] 72 / 4e-17 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.018G063400 [exp] 72 / 5e-17 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2) Potri.006G278100 [exp] 72 / 9e-17 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 70 / 1e-16 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 70 / 1e-16 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.013G111000 [exp] 69 / 2e-16 AT4G09530 93 / 3e-26 SAUR-like auxin-responsive protein family (.1) Potri.001G060400 [exp] 71 / 6e-16 AT5G50760 71 / 5e-15 SAUR-like auxin-responsive protein family (.1) Potri.019G082100 [exp] 68 / 6e-16 AT4G09530 85 / 3e-23 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017018 [exp] 158 / 5e-51 AT2G36210 124 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10021341 [exp] 155 / 5e-50 AT2G36210 123 / 4e-37 SAUR-like auxin-responsive protein family (.1) Lus10034888 [exp] 79 / 3e-19 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2) Lus10026977 [exp] 72 / 1e-16 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1) Lus10031178 [exp] 68 / 4e-15 AT1G56150 128 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10031754 [exp] 67 / 5e-15 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1) Lus10012189 [exp] 66 / 5e-15 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10007553 [exp] 66 / 1e-14 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 63 / 8e-14 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10024326 [exp] 62 / 2e-13 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.006G211000.1 pacid=42770044 polypeptide=Potri.006G211000.1.p locus=Potri.006G211000 ID=Potri.006G211000.1.v4.1 annot-version=v4.1 ATGTTGGGCAAAAAGATCGTTTCTTTCAAGAAACTTGCCAAGAAGGTGAAGGATATCAGTAGAAATGAGTGCAAGCAATCACAGCATGAATGCTTACTAA GGGATCATAATTTTGATGATGGGGTCACAACCCCAACAGGGTTTTTTGCTATATATGTAGGGGAAGACAGGGAAAGGTTTGTGGTGCCAACAAGCTGTCT CTCCCATCCGCTCTTCAAAATGTTGTTGGAGAAGTCATATAACGTGTTTGGTTTCGATCAAAGGAATAGGCTTGTGGTTCCATGCAACGTCTCCACATTT CAAGAGGTTCTCAATGCTGTTGAATGTTGTAACGGAAGGTTTGACTTTGGAAATTTGGTTGAGGAGTTTCTATAG
AA sequence Show only first row Show all	>Potri.006G211000.1 pacid=42770044 polypeptide=Potri.006G211000.1.p locus=Potri.006G211000 ID=Potri.006G211000.1.v4.1 annot-version=v4.1 MLGKKIVSFKKLAKKVKDISRNECKQSQHECLLRDHNFDDGVTTPTGFFAIYVGEDRERFVVPTSCLSHPLFKMLLEKSYNVFGFDQRNRLVVPCNVSTF QEVLNAVECCNGRFDFGNLVEEFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G36210			SAUR-like auxin-responsive pro...		Potri.006G211000 [exp]	0	1
AT2G40470	AS2	ASL11, LBD15	ASYMMETRIC LEAVES2-LIKE 11, LO...		Potri.013G156200 [exp]	1.00	0.9356
AT4G12350	MYB	ATMYB42	myb domain protein 42 (.1)		Potri.001G118800 [exp]	3.16	0.8768
AT5G60550		ATSNAK1, GRIK2	geminivirus rep interacting ki...		Potri.003G215201 [exp]	6.00	0.8279
AT3G10410		CPY, SCPL49	CARBOXYPEPTIDASE Y, SERINE CAR...		Potri.008G034800 [exp]	6.00	0.8647
AT2G20680		MAN2, AtMAN2	endo-beta-mannase 2, Glycosyl ...		Potri.013G130400 [exp]	7.93	0.7955
AT4G12350	MYB	ATMYB42	myb domain protein 42 (.1)		Potri.003G114100 [exp]	8.00	0.8577	MYB85.1
AT1G55760			BTB/POZ domain-containing prot...		Potri.001G468700 [exp]	8.36	0.8300
AT5G03760		ATCSLA9, RAT4, ...	RESISTANT TO AGROBACTERIUM TRA...		Potri.008G026400 [exp]	8.83	0.8383	Pt-MANS.1
AT5G22400			Rho GTPase activating protein ...		Potri.006G211200 [exp]	10.00	0.8554
AT5G47635			Pollen Ole e 1 allergen and ex...		Potri.016G006200 [exp]	13.85	0.8316

Compare expression of checked genes

Potri.006G211000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.