Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52630 156 / 6e-51 Nucleic acid-binding, OB-fold-like protein (.1.2) AT4G18590 149 / 5e-48 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G211900 [exp] 224 / 9e-78 AT3G52630 155 / 8e-51 Nucleic acid-binding, OB-fold-like protein (.1.2) Potri.010G239200 [exp] 134 / 2e-42 AT4G18590 135 / 1e-42 Nucleic acid-binding, OB-fold-like protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014209 [exp] 180 / 2e-60 AT4G18590 151 / 4e-49 Nucleic acid-binding, OB-fold-like protein (.1) Lus10022705 [exp] 176 / 8e-59 AT4G18590 147 / 3e-47 Nucleic acid-binding, OB-fold-like protein (.1) Lus10014210 [exp] 171 / 1e-56 AT4G18590 143 / 2e-45 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [poplar] [flax] OB PF08661 [poplar] [flax] Rep_fac-A_3 Replication factor A protein 3
Representative CDS sequence Show only first row Show all	>Potri.006G212100.3 pacid=42766910 polypeptide=Potri.006G212100.3.p locus=Potri.006G212100 ID=Potri.006G212100.3.v4.1 annot-version=v4.1 ATGGATACATCAAAACCTGCGATTTTTGTCAACGGGGCACTTTTGCCGATGCATGTTCGAAAGAGGGTCCGGACTGTGATTCAAGTTGTGGGAGCTGATC GTGGAGCAGTAGTTGGAAAATCCCCGGATGATCTCCAGCTTGTTGTAAAAGGCTCTCCGCCATCTGCTCCTCTTACAAATTTTGTTGAGGTTATTGGCAT TGCTGACAGTGAAAAATCAATCCAGGCTGAGATATGGACCAACTTTGGGGATGCATTTGATACATACAACTACAATCAGCTGTGTCAGCTTGCAAATGGG GAATACCAGCACTTATTCCTCTGA
AA sequence Show only first row Show all	>Potri.006G212100.3 pacid=42766910 polypeptide=Potri.006G212100.3.p locus=Potri.006G212100 ID=Potri.006G212100.3.v4.1 annot-version=v4.1 MDTSKPAIFVNGALLPMHVRKRVRTVIQVVGADRGAVVGKSPDDLQLVVKGSPPSAPLTNFVEVIGIADSEKSIQAEIWTNFGDAFDTYNYNQLCQLANG EYQHLFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G52630			Nucleic acid-binding, OB-fold-...		Potri.006G212100 [exp]	0	1
AT1G48380		HYP7, RHL1	HYPOCOTYL 7, root hair initiat...		Potri.004G069400 [exp]	4.47	0.8170
AT3G20630		PER1, ATUBP14, ...	TITAN6, phosphate deficiency r...		Potri.011G125800 [exp]	5.29	0.7956	Pt-UBP14.1
AT5G37930			Protein with RING/U-box and TR...		Potri.017G122800 [exp]	6.55	0.8484
AT5G64630		MUB3.9, NFB1, N...	FASCIATA 2, Transducin/WD40 re...		Potri.007G108200 [exp]	8.94	0.8338
AT4G34110		PABP2, PAB2, AT...	ARABIDOPSIS POLY\(A\) BINDING ...		Potri.001G304000 [exp]	12.00	0.8118
AT2G16780		MSI02, NFC2, NF...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Potri.009G135100 [exp]	23.68	0.7895	NFC903,Pt-MSI2.1
AT4G03390		SRF3	STRUBBELIG-receptor family 3 (...		Potri.019G103900 [exp]	24.49	0.7938
AT1G27880			DEAD/DEAH box RNA helicase fam...		Potri.010G056500 [exp]	26.49	0.8128
AT1G79950			RAD3-like DNA-binding helicase...		Potri.001G180200 [exp]	28.46	0.7775
AT4G14970			unknown protein		Potri.006G023500 [exp]	33.31	0.8137

Compare expression of checked genes

Potri.006G212100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.