Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38870 81 / 4e-22 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43580 71 / 5e-18 UPI UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT2G38900 67 / 2e-16 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) AT3G46860 50 / 1e-09 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43570 44 / 3e-07 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G212000 [exp] 133 / 4e-43 AT2G38870 81 / 5e-22 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.016G079050 [exp] 133 / 7e-43 AT2G38870 81 / 2e-22 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.016G078900 [exp] 130 / 7e-42 AT2G38870 84 / 2e-23 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.016G078800 [exp] 130 / 9e-42 AT2G38870 79 / 3e-21 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075501 [exp] 87 / 2e-24 AT5G43580 77 / 2e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075300 [exp] 87 / 2e-24 AT5G43580 77 / 2e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075600 [exp] 86 / 3e-24 AT5G43580 80 / 3e-21 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075800 [exp] 86 / 4e-24 AT2G38870 76 / 3e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075400 [exp] 85 / 9e-24 AT2G38870 84 / 3e-23 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018783 [exp] 85 / 1e-23 AT2G38870 89 / 2e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018784 [exp] 84 / 2e-23 AT2G38870 89 / 1e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018786 [exp] 78 / 5e-21 AT2G38870 93 / 6e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10024870 [exp] 76 / 4e-20 AT2G38870 94 / 2e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10002732 [exp] 68 / 4e-17 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10014740 [exp] 62 / 8e-15 AT2G38870 77 / 2e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10043097 [exp] 65 / 5e-14 AT1G52870 505 / 2e-179 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10032655 [exp] 64 / 8e-14 AT1G52870 499 / 3e-176 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10035626 [exp] 45 / 8e-08 AT2G38900 43 / 8e-07 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) Lus10003225 [exp] 44 / 3e-07 AT2G38900 42 / 1e-06 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0367 [poplar] [flax] CI-2 PF00280 [poplar] [flax] potato_inhibit Potato inhibitor I family
Representative CDS sequence Show only first row Show all	>Potri.006G212200.1 pacid=42769363 polypeptide=Potri.006G212200.1.p locus=Potri.006G212200 ID=Potri.006G212200.1.v4.1 annot-version=v4.1 ATGGCATCAGAATGTCAAGGTAAGAGTTCATGGCCAGAGCTCCTTGGAGCGCAAGCAAGGGTTGCGGTAGCCACTATTGAAACGGAGAATCCTTATGTGG ACACTCAGGTTGTGTTAGAAGGAACGCCTGTGACTGGAGAGTTCTCTTGCACTAGGGTTCGTGTTTGGATTGACAGGAACAGAATTGTTACTCGGGTTCC TGTAATTGGTTGA
AA sequence Show only first row Show all	>Potri.006G212200.1 pacid=42769363 polypeptide=Potri.006G212200.1.p locus=Potri.006G212200 ID=Potri.006G212200.1.v4.1 annot-version=v4.1 MASECQGKSSWPELLGAQARVAVATIETENPYVDTQVVLEGTPVTGEFSCTRVRVWIDRNRIVTRVPVIG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G38870			Serine protease inhibitor, pot...		Potri.006G212200 [exp]	0	1
AT2G38870			Serine protease inhibitor, pot...		Potri.010G075400 [exp]	1.00	0.9673	BGIT.1
AT5G43580		UPI	UNUSUAL SERINE PROTEASE INHIBI...		Potri.010G075300 [exp]	2.00	0.9657
AT1G35910		TPPD	trehalose-6-phosphate phosphat...		Potri.012G001000 [exp]	2.44	0.9626
					Potri.001G472101 [exp]	3.46	0.9579
AT5G43580		UPI	UNUSUAL SERINE PROTEASE INHIBI...		Potri.010G075501 [exp]	4.24	0.9549
					Potri.016G047700 [exp]	4.47	0.9578
AT4G20820			FAD-binding Berberine family p...		Potri.011G163000 [exp]	4.69	0.9347
AT2G24130			Leucine-rich receptor-like pro...		Potri.018G103400 [exp]	5.29	0.9329
AT5G27060		AtRLP53	receptor like protein 53 (.1)		Potri.001G389100 [exp]	5.65	0.9443	PSCLRR52.53
AT5G14420		RGLG2	RING domain ligase2 (.1.2.3.4)		Potri.006G002600 [exp]	6.00	0.9413

Compare expression of checked genes

Potri.006G212200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.