Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02580 96 / 1e-27 Plant protein 1589 of unknown function (.1.2) AT3G55240 89 / 5e-25 Plant protein 1589 of unknown function (.1) AT3G28990 77 / 3e-20 Plant protein 1589 of unknown function (.1) AT1G10657 57 / 2e-12 Plant protein 1589 of unknown function (.1.2.3.4) AT5G04090 37 / 0.0005 Plant protein 1589 of unknown function (.1.2) AT2G46420 37 / 0.0007 Plant protein 1589 of unknown function (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G211500 [exp] 96 / 2e-27 AT3G55240 113 / 3e-34 Plant protein 1589 of unknown function (.1) Potri.008G189100 [exp] 63 / 1e-14 AT1G10657 122 / 8e-38 Plant protein 1589 of unknown function (.1.2.3.4) Potri.010G042300 [exp] 60 / 2e-13 AT1G10657 119 / 1e-36 Plant protein 1589 of unknown function (.1.2.3.4) Potri.015G019500 [exp] 37 / 0.0003 AT3G61700 161 / 1e-46 Plant protein 1589 of unknown function (.1.2) Potri.006G041200 [exp] 36 / 0.001 AT3G10250 396 / 4e-139 Plant protein 1589 of unknown function (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024432 [exp] 95 / 6e-27 AT5G02580 112 / 1e-33 Plant protein 1589 of unknown function (.1.2) Lus10025300 [exp] 92 / 7e-26 AT5G02580 115 / 5e-35 Plant protein 1589 of unknown function (.1.2) Lus10003293 [exp] 44 / 3e-07 AT3G55240 85 / 2e-23 Plant protein 1589 of unknown function (.1) Lus10030322 [exp] 44 / 3e-07 AT3G55240 83 / 1e-22 Plant protein 1589 of unknown function (.1) Lus10004016 [exp] 38 / 0.0003 AT3G61700 253 / 3e-83 Plant protein 1589 of unknown function (.1.2) Lus10031001 [exp] 38 / 0.0004 AT3G10250 392 / 3e-137 Plant protein 1589 of unknown function (.1.2) Lus10035397 [exp] 37 / 0.0006 AT3G23270 526 / 2e-171 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09713 [poplar] [flax] A_thal_3526 Plant protein 1589 of unknown function (A_thal_3526)
Representative CDS sequence Show only first row Show all	>Potri.006G213500.1 pacid=42770259 polypeptide=Potri.006G213500.1.p locus=Potri.006G213500 ID=Potri.006G213500.1.v4.1 annot-version=v4.1 ATGGGTGATTCTTCTGCTTCATACATCCACATGGTGCACCATCTAATAGAAGAGTGCATCATATTCAACATGAGCAAAGAAGAGTGCATGGAAGCTCTGT CCAAGCATGCTGACATCAAACCTGTCATTACTTCCACAGTATGGAAGGAGTTGGAGAAAGAAAACAAGGAGTTCTTCGAGGCCTACGAGAAGAGAAGAGG AGAGAAAGCTGTTCAAGAAGGGGATAAAAGCACGGGATCCAAGACATGA
AA sequence Show only first row Show all	>Potri.006G213500.1 pacid=42770259 polypeptide=Potri.006G213500.1.p locus=Potri.006G213500 ID=Potri.006G213500.1.v4.1 annot-version=v4.1 MGDSSASYIHMVHHLIEECIIFNMSKEECMEALSKHADIKPVITSTVWKELEKENKEFFEAYEKRRGEKAVQEGDKSTGSKT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G02580			Plant protein 1589 of unknown ...		Potri.006G213500 [exp]	0	1
AT3G50700	C2H2ZnF	ATIDD2	indeterminate(ID)-domain 2 (.1...		Potri.002G208444 [exp]	3.46	0.9237
AT1G75540	CO	LHUS, AtBBX21, ...	long hypocotyl under shade, B-...		Potri.005G234500 [exp]	6.32	0.9024	Pt-COL6.1
AT5G60910	MADS	FUL, AGL8	FRUITFULL, AGAMOUS-like 8 (.1....		Potri.004G115400 [exp]	9.16	0.9021
AT3G60390	HD	HAT3	homeobox-leucine zipper protei...		Potri.002G136400 [exp]	10.00	0.8972	Pt-ATHB.8
AT3G63520		ATNCED1, ATCCD1...	carotenoid cleavage dioxygenas...		Potri.006G239300 [exp]	11.22	0.8702
AT5G51440			HSP20-like chaperones superfam...		Potri.006G034600 [exp]	14.17	0.8280
AT2G47810	CCAAT	NF-YB5	"nuclear factor Y, subunit B5"...		Potri.008G210300 [exp]	15.42	0.8940
					Potri.015G143650 [exp]	16.79	0.8945
AT3G56880			VQ motif-containing protein (....		Potri.006G032300 [exp]	20.97	0.8464
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Potri.014G037700 [exp]	24.81	0.8866

Compare expression of checked genes

Potri.006G213500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.