Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39390 186 / 3e-62 Ribosomal L29 family protein (.1) AT5G02610 185 / 8e-62 Ribosomal L29 family protein (.1.2) AT3G09500 184 / 2e-61 Ribosomal L29 family protein (.1) AT3G55170 183 / 5e-61 Ribosomal L29 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G214100 [exp] 190 / 5e-64 AT2G39390 189 / 2e-63 Ribosomal L29 family protein (.1) Potri.010G212300 [exp] 189 / 1e-63 AT2G39390 213 / 4e-73 Ribosomal L29 family protein (.1) Potri.008G048800 [exp] 187 / 8e-63 AT5G02610 177 / 1e-58 Ribosomal L29 family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025292 [exp] 189 / 1e-63 AT5G02610 221 / 5e-76 Ribosomal L29 family protein (.1.2) Lus10003306 [exp] 187 / 8e-63 AT3G09500 218 / 6e-75 Ribosomal L29 family protein (.1) Lus10030314 [exp] 186 / 5e-62 AT3G09500 214 / 2e-73 Ribosomal L29 family protein (.1) Lus10019179 [exp] 184 / 2e-61 AT5G02610 210 / 7e-72 Ribosomal L29 family protein (.1.2) Lus10024437 [exp] 184 / 2e-61 AT5G02610 218 / 6e-75 Ribosomal L29 family protein (.1.2) Lus10023449 [exp] 181 / 3e-60 AT5G02610 209 / 5e-71 Ribosomal L29 family protein (.1.2) Lus10019180 [exp] 145 / 2e-46 AT5G02610 172 / 4e-57 Ribosomal L29 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0346 [poplar] [flax] Ribo_L29 PF00831 [poplar] [flax] Ribosomal_L29 Ribosomal L29 protein
Representative CDS sequence Show only first row Show all	>Potri.006G214200.2 pacid=42769013 polypeptide=Potri.006G214200.2.p locus=Potri.006G214200 ID=Potri.006G214200.2.v4.1 annot-version=v4.1 ATGGCAAGGATAAAGGTTCATGAGTTGAGGGAAAAGTCCAAGACAGAGCTGCTGGCCCAGCTGAAGGAGCTCAAAGCAGAGCTCGCTCTCCTCCGTGTTG CCAAGGTTACTGGCGGTGCCCCTAACAAGCTCTCCAAGATAAAGGTGGTGAGGTTGTCAATAGCGCAGGTGTTGACCGTGATATCACAGAAACAGAAAGC CGCACTCAGGGAAGCTTACAAGAATAAGAAGTTTCTGCCTCTTGATCTTCGTCCCAAGAAAACTCGTGCCATTCGCAGACGTCTTACTAAACACCAGGCA TCTTTGAAGACAAAACGTGAGGAAAAGAGGGAGATGTACTTCCCGATGAGAAAGTATGCAATCAAAGTTTAG
AA sequence Show only first row Show all	>Potri.006G214200.2 pacid=42769013 polypeptide=Potri.006G214200.2.p locus=Potri.006G214200 ID=Potri.006G214200.2.v4.1 annot-version=v4.1 MARIKVHELREKSKTELLAQLKELKAELALLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKFLPLDLRPKKTRAIRRRLTKHQA SLKTKREEKREMYFPMRKYAIKV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G39390			Ribosomal L29 family protein ...		Potri.006G214200 [exp]	0	1
AT3G53020		RPL24B, STV1	SHORT VALVE1, Ribosomal protei...		Potri.015G141900 [exp]	1.00	0.9893
AT1G15250			Zinc-binding ribosomal protein...		Potri.018G036900 [exp]	2.44	0.9681
AT3G05560			Ribosomal L22e protein family ...		Potri.010G012700 [exp]	2.82	0.9645	RPL22.5
AT3G12390			Nascent polypeptide-associated...		Potri.003G190800 [exp]	3.16	0.9632
AT3G02560			Ribosomal protein S7e family p...		Potri.016G100400 [exp]	4.89	0.9662
AT5G43970		ATTOM22-V, TOM2...	TRANSLOCASE OUTER MITOCHONDRIA...		Potri.002G257200 [exp]	6.32	0.9574	TOM22.1
AT1G22450		ATCOX6B2, COX6B	CYTOCHROME C OXIDASE 6B2, cyto...		Potri.005G162100 [exp]	7.34	0.9487	COX6.2
AT1G19580		GAMMACA1 ,GAMMA...	gamma carbonic anhydrase 1 (.1...		Potri.002G034100 [exp]	10.09	0.9489	APFI.1
AT5G64140		RPS28	ribosomal protein S28 (.1)		Potri.016G063100 [exp]	10.58	0.9528
AT5G14030			translocon-associated protein ...		Potri.001G323400 [exp]	10.67	0.9484

Compare expression of checked genes

Potri.006G214200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.