Potri.006G215800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02740 139 / 3e-40 Ribosomal protein S24e family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G089800 103 / 3e-28 AT5G02740 43 / 4e-06 Ribosomal protein S24e family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015045 160 / 1e-48 AT5G02740 178 / 4e-56 Ribosomal protein S24e family protein (.1.2)
Lus10003991 157 / 2e-47 AT5G02740 181 / 2e-57 Ribosomal protein S24e family protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.006G215800.1 pacid=42766938 polypeptide=Potri.006G215800.1.p locus=Potri.006G215800 ID=Potri.006G215800.1.v4.1 annot-version=v4.1
ATGAGCCTCTTACTAAGAAAAACAATCAAATCAAACTCCAGTCTCCAATCTTTCAAGCCGAACAATGCCCTCTCTTTATTCCTGCGCCAATCCACAAAGC
ATTTCTCCACCGAGACTCAACCACCACCGCCACCACAAGAGAATAATGATCCATCCTCAATCGATCCATTTCTTCAAGATTCAGCTACCAGTTTGACGTA
TGCAAGATTTCATGGTGTAAGGAAGCATACATTGAAGACAGACATTATTAATTTATTTGAAGGCTCTAATTTGACACCTGATGATATTATAGTCGTTCAC
CACCGCTTCAATAATAATCCCTATGCTGCAGCGATAAAATTTCCTTCTAGAAGAGCATATGATAATGCTCAGAGGTCACTCACGCGGGCGGGCCGTATAT
ACAATTTGGAAAAGACTCCGCCTACTGTGTGGGATGCCGCACTTCGAAATTCTTATGATGGAAAAACTGTTTTACTGGAAGGACTCCCTCCAAATGCACT
TAACGAAGATATAGAGCGCTTCCTGTCTGGCTGTAAATTTGTTCCATCCTCAATCAGGACGTTTGTAAAGTATCCAGATCCCGTTATGTCTGCAGGAAGA
AAGAATCCCACCACTTCTGCAGGAAAACAAGATGGCACTACCTCTGAAGAAAAAAGAGATCCCATTAGAATGGCTACCGTACTCTTTTCTACACGGACTG
AGGCGATGAATGCCTTAATTAAAAAGAATCGAGGCTTCTGTCTCAATAATCAAATCTCAGTGCGGGTTCTCCATTAA
AA sequence
>Potri.006G215800.1 pacid=42766938 polypeptide=Potri.006G215800.1.p locus=Potri.006G215800 ID=Potri.006G215800.1.v4.1 annot-version=v4.1
MSLLLRKTIKSNSSLQSFKPNNALSLFLRQSTKHFSTETQPPPPPQENNDPSSIDPFLQDSATSLTYARFHGVRKHTLKTDIINLFEGSNLTPDDIIVVH
HRFNNNPYAAAIKFPSRRAYDNAQRSLTRAGRIYNLEKTPPTVWDAALRNSYDGKTVLLEGLPPNALNEDIERFLSGCKFVPSSIRTFVKYPDPVMSAGR
KNPTTSAGKQDGTTSEEKRDPIRMATVLFSTRTEAMNALIKKNRGFCLNNQISVRVLH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G02740 Ribosomal protein S24e family ... Potri.006G215800 0 1
AT4G05400 copper ion binding (.1.2) Potri.011G098000 2.82 0.8439
AT1G61870 PPR336 pentatricopeptide repeat 336 (... Potri.004G018000 5.09 0.8109
AT1G18800 NRP2 NAP1-related protein 2 (.1) Potri.017G080700 6.70 0.8012
AT3G15010 RNA-binding (RRM/RBD/RNP motif... Potri.016G048100 11.40 0.7797
AT1G71730 unknown protein Potri.002G063100 12.32 0.8025
AT3G10950 Zinc-binding ribosomal protein... Potri.003G085100 15.00 0.7919
AT2G42710 Ribosomal protein L1p/L10e fam... Potri.014G143000 17.32 0.7991
AT5G02050 Mitochondrial glycoprotein fam... Potri.006G090700 17.60 0.7915 Pt-SDH4.3
AT5G63150 unknown protein Potri.012G090700 17.94 0.7957
AT3G15000 cobalt ion binding (.1) Potri.001G393400 21.90 0.8066

Potri.006G215800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.