Potri.006G215866 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G082200 0 / 1 AT2G37320 602 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.006G215866.1 pacid=42770395 polypeptide=Potri.006G215866.1.p locus=Potri.006G215866 ID=Potri.006G215866.1.v4.1 annot-version=v4.1
ATGAAGATAGGAGCTTATGGACCAGCATTCTCGTGTATAGCTTCGCTGACCTCTTGCATTTCAGCTGCAGCCAGGATTCGTTTTAATTCTATCCTTCATC
AATTTGCTCACTCTAGCCGCCTGATCCCAGAACCTCACAGTAGCATACAAGTTCGCCAACTGCACTTGGGTAGCACAGCGCACCCTGGTTCCAGCAACAG
CCTGTTCTCTGCAGCTTGCATGTTAATCCAAACACTCCCACGAATATAA
AA sequence
>Potri.006G215866.1 pacid=42770395 polypeptide=Potri.006G215866.1.p locus=Potri.006G215866 ID=Potri.006G215866.1.v4.1 annot-version=v4.1
MKIGAYGPAFSCIASLTSCISAAARIRFNSILHQFAHSSRLIPEPHSSIQVRQLHLGSTAHPGSSNSLFSAACMLIQTLPRI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G37320 Tetratricopeptide repeat (TPR)... Potri.006G215866 0 1
AT5G01260 Carbohydrate-binding-like fold... Potri.009G044800 4.47 0.8727
Potri.001G145750 6.63 0.8566
AT1G03220 Eukaryotic aspartyl protease f... Potri.006G068900 7.87 0.8767
AT5G14950 GMII, ATGMII golgi alpha-mannosidase II (.1... Potri.001G350400 9.64 0.8744
AT5G05160 REDUCED IN LATE... REDUCED IN LATERAL GROWTH1, Le... Potri.001G209700 10.95 0.8303
AT2G03360 Glycosyltransferase family 61 ... Potri.010G162200 11.74 0.8689
Potri.017G120700 13.78 0.8198
AT5G44360 FAD-binding Berberine family p... Potri.011G161800 14.59 0.7838
Potri.008G073050 15.00 0.7823
Potri.002G220667 15.58 0.8634

Potri.006G215866 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.