Potri.006G217000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20885 138 / 5e-42 RING/U-box superfamily protein (.1)
AT3G43430 123 / 4e-36 RING/U-box superfamily protein (.1)
AT3G61460 67 / 4e-14 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT3G60220 67 / 1e-13 ATL4 TOXICOS EN LEVADURA 4 (.1)
AT5G41400 65 / 3e-13 RING/U-box superfamily protein (.1)
AT4G00305 61 / 2e-12 RING/U-box superfamily protein (.1)
AT2G42360 59 / 5e-11 RING/U-box superfamily protein (.1)
AT1G63840 57 / 1e-10 RING/U-box superfamily protein (.1)
AT3G48030 57 / 6e-10 hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein (.1)
AT3G62690 56 / 7e-10 ATL5 AtL5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G046900 227 / 5e-77 AT5G20885 136 / 4e-41 RING/U-box superfamily protein (.1)
Potri.002G161900 67 / 3e-14 AT3G61460 234 / 7e-80 brassinosteroid-responsive RING-H2 (.1)
Potri.014G087700 66 / 4e-14 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1)
Potri.001G101000 66 / 1e-13 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1)
Potri.003G130900 64 / 5e-13 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1)
Potri.011G150800 59 / 4e-11 AT3G61460 69 / 1e-14 brassinosteroid-responsive RING-H2 (.1)
Potri.007G086300 57 / 1e-10 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.001G309700 56 / 1e-09 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1)
Potri.008G165900 56 / 1e-09 AT1G04360 312 / 2e-104 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019507 150 / 3e-46 AT5G20885 162 / 5e-51 RING/U-box superfamily protein (.1)
Lus10043353 148 / 1e-45 AT5G20885 157 / 4e-49 RING/U-box superfamily protein (.1)
Lus10032290 69 / 6e-15 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10028773 68 / 9e-15 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1)
Lus10024657 67 / 4e-14 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10017510 66 / 9e-14 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1)
Lus10036378 63 / 2e-12 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1)
Lus10008283 59 / 3e-11 AT3G61460 77 / 5e-18 brassinosteroid-responsive RING-H2 (.1)
Lus10032161 56 / 2e-09 AT5G40250 413 / 7e-144 RING/U-box superfamily protein (.1)
Lus10019973 56 / 3e-09 AT4G30400 252 / 4e-80 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.006G217000.2 pacid=42767965 polypeptide=Potri.006G217000.2.p locus=Potri.006G217000 ID=Potri.006G217000.2.v4.1 annot-version=v4.1
ATGGGTTTTTTTGTAGAAGAGTCAGGGTTGATAGTGACCCATCTTTTATACAAGGCAGCTCTTGTATTAGCAGTCTTGAGATGGGCCTTGGCTTGGGCTC
TGAGATTCAAAAACAGAACCCATTTAGCCTCTCCCAGCAATGATTCTCTACGGCGATCTCATCCTGTTCCTTCTTCGCAGCAAATTAGGGACGGTCTGAT
CTTGACCACTTTCGGTGATGTCACAGAGAGGATGCCAGGAGTTTGTGACACATGTGCTGTCTGCTTGAGCCAGCTGAGGGATCAAGATGAGGTCAGAGAG
TTGAGGAATTGCTGCCACGTGTTCCACAGGGATTGCATTGATAGATGGGTAGATCACGATCATGAGCATGATGAGAATCACAACACCTGCCCTCTGTGTA
GGGCACCGTTGCTGACAACCTCGCAGAGCCTGGCTAGGACCAGGGCTGAGCCTAGTTGGGCTGTTGAGAGAATTCTCTACCTCTTTGGGGATGACTTGGT
GATGTGA
AA sequence
>Potri.006G217000.2 pacid=42767965 polypeptide=Potri.006G217000.2.p locus=Potri.006G217000 ID=Potri.006G217000.2.v4.1 annot-version=v4.1
MGFFVEESGLIVTHLLYKAALVLAVLRWALAWALRFKNRTHLASPSNDSLRRSHPVPSSQQIRDGLILTTFGDVTERMPGVCDTCAVCLSQLRDQDEVRE
LRNCCHVFHRDCIDRWVDHDHEHDENHNTCPLCRAPLLTTSQSLARTRAEPSWAVERILYLFGDDLVM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G20885 RING/U-box superfamily protein... Potri.006G217000 0 1
AT1G12500 Nucleotide-sugar transporter f... Potri.001G114100 5.56 0.9151
AT5G42330 unknown protein Potri.002G010400 6.00 0.8949
AT4G15960 alpha/beta-Hydrolases superfam... Potri.010G010800 6.70 0.8978
AT3G50770 CML41 calmodulin-like 41 (.1) Potri.007G031900 13.26 0.8839
AT2G22250 ATAAT, AAT, MEE... MATERNAL EFFECT EMBRYO ARREST ... Potri.005G079200 13.41 0.8998
AT5G66060 2-oxoglutarate (2OG) and Fe(II... Potri.005G108000 17.40 0.9025
AT4G25680 PPPDE putative thiol peptidase... Potri.004G079800 17.43 0.8622
Potri.013G156300 17.54 0.8714
AT1G06550 ATP-dependent caseinolytic (Cl... Potri.002G057700 18.08 0.8323
AT4G23496 SP1L5 SPIRAL1-like5 (.1) Potri.001G100100 18.57 0.8467

Potri.006G217000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.