Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54630 94 / 2e-25 ACP3 acyl carrier protein 3 (.1.2) AT3G05020 92 / 2e-24 ACP1 acyl carrier protein 1 (.1) AT1G54580 91 / 4e-24 ACP2 acyl carrier protein 2 (.1) AT4G25050 90 / 2e-23 ACP4 acyl carrier protein 4 (.1.2) AT5G27200 88 / 7e-23 ACP5 acyl carrier protein 5 (.1) AT1G65290 57 / 3e-11 MTACP2 mitochondrial acyl carrier protein 2 (.1) AT2G44620 51 / 7e-09 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1) AT5G47630 41 / 5e-05 MTACP3 mitochondrial acyl carrier protein 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G047201 [exp] 136 / 3e-42 ND / Potri.005G044800 [exp] 96 / 4e-26 AT5G27200 146 / 5e-46 acyl carrier protein 5 (.1) Potri.015G104500 [exp] 93 / 8e-25 AT4G25050 122 / 2e-36 acyl carrier protein 4 (.1.2) Potri.012G105300 [exp] 91 / 4e-24 AT4G25050 107 / 8e-31 acyl carrier protein 4 (.1.2) Potri.013G031300 [exp] 89 / 2e-23 AT3G05020 142 / 1e-44 acyl carrier protein 1 (.1) Potri.013G084500 [exp] 57 / 5e-11 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1) Potri.014G044000 [exp] 56 / 2e-10 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1) Potri.019G055300 [exp] 53 / 1e-09 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1) Potri.002G135600 [exp] 52 / 5e-09 AT2G44620 177 / 1e-58 mitochondrial acyl carrier protein 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018986 [exp] 99 / 4e-27 AT4G25050 136 / 3e-42 acyl carrier protein 4 (.1.2) Lus10033836 [exp] 96 / 6e-26 AT4G25050 137 / 2e-42 acyl carrier protein 4 (.1.2) Lus10038636 [exp] 88 / 9e-23 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2) Lus10038635 [exp] 88 / 9e-23 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2) Lus10037910 [exp] 87 / 2e-22 AT4G25050 130 / 4e-40 acyl carrier protein 4 (.1.2) Lus10037908 [exp] 87 / 2e-22 AT4G25050 132 / 8e-41 acyl carrier protein 4 (.1.2) Lus10043348 [exp] 56 / 2e-10 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10019500 [exp] 56 / 2e-10 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10020221 [exp] 55 / 5e-10 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1) Lus10026849 [exp] 56 / 1e-09 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0314 [poplar] [flax] PP-binding PF00550 [poplar] [flax] PP-binding Phosphopantetheine attachment site
Representative CDS sequence Show only first row Show all	>Potri.006G217800.1 pacid=42767695 polypeptide=Potri.006G217800.1.p locus=Potri.006G217800 ID=Potri.006G217800.1.v4.1 annot-version=v4.1 ATGGCCAGCTTCCTTGCAGCCCCTGCATGTCCACTGGTTGCCCTGCCCACCACTACCAGGGCCAGTTTCTCCACCGTTCAGCAAAAGAGCTTCTCTGTCA ATGGAGGCCCTTTATTTTTCGGGCTAAAACATGCCCAGAATATTCAATTCTCAAAGGCAGCTAGCATTTCCTCTACCAGGTCTAGATGCTTCAAGGCCAC AATTTCATGCTCTGCTCAACCTGAAACCCTGGAAACCGTCCAAAGCACCATTGCTAAGCAATTGTCTGTTGAAGTCAGCACAGTAACTCCTGAAACCAAG TTTGCTGACTTGGGTGCTGACTCCCTTGACACGGTAGAAATAATGATGGCTTTGGAAGAACAATTCGGCGTGTCAATAGGCGAAGGTGGTGCAGAGAACA TTGCAACTGTTCAAGATGCTGCAGATCTCATTGAGAAAGTGAAGGCAGCAGCATGA
AA sequence Show only first row Show all	>Potri.006G217800.1 pacid=42767695 polypeptide=Potri.006G217800.1.p locus=Potri.006G217800 ID=Potri.006G217800.1.v4.1 annot-version=v4.1 MASFLAAPACPLVALPTTTRASFSTVQQKSFSVNGGPLFFGLKHAQNIQFSKAASISSTRSRCFKATISCSAQPETLETVQSTIAKQLSVEVSTVTPETK FADLGADSLDTVEIMMALEEQFGVSIGEGGAENIATVQDAADLIEKVKAAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G54630		ACP3	acyl carrier protein 3 (.1.2)		Potri.006G217800 [exp]	0	1
					Potri.014G082000 [exp]	1.00	0.9992
					Potri.005G224300 [exp]	2.00	0.9978
AT2G38110		ATGPAT6, GPAT6	glycerol-3-phosphate acyltrans...		Potri.006G198100 [exp]	2.44	0.9975
AT1G59740			Major facilitator superfamily ...		Potri.004G064100 [exp]	4.47	0.9980
					Potri.003G126200 [exp]	5.47	0.9978
					Potri.002G158600 [exp]	6.70	0.9978
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.008G213223 [exp]	8.36	0.9969
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.010G000400 [exp]	8.36	0.9973	MALD1.1
AT4G18950			Integrin-linked protein kinase...		Potri.017G123100 [exp]	8.48	0.9968
AT3G08680			Leucine-rich repeat protein ki...		Potri.011G088000 [exp]	11.31	0.9972

Compare expression of checked genes

Potri.006G217800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.