Potri.006G218850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G43920 77 / 2e-18 DCL3, ATDCL3 dicer-like 3 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G047500 127 / 4e-36 AT3G43920 1518 / 0.0 dicer-like 3 (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016367 81 / 8e-20 AT3G43920 1457 / 0.0 dicer-like 3 (.1.2.3)
Lus10019757 79 / 4e-19 AT3G43920 1379 / 0.0 dicer-like 3 (.1.2.3)
PFAM info
Representative CDS sequence
>Potri.006G218850.2 pacid=42767316 polypeptide=Potri.006G218850.2.p locus=Potri.006G218850 ID=Potri.006G218850.2.v4.1 annot-version=v4.1
ATGAAGAAAGGAGGACCTCGTACTGCTCTTTACGATCTTTGTAAGAAAGTTCAGTGGCCAATGCCTACATTTGATACAACAGAAACGAAATCCAGAACTG
CAATTGAATTCGGTGAAGGCCCCCAAAAAAGAAAGGGGTTTAACAGTTACGTATCAAAAACCATCTTGAACATGCCGTCTTTTGGCGTTGTTGAATGCGA
GGGCTGA
AA sequence
>Potri.006G218850.2 pacid=42767316 polypeptide=Potri.006G218850.2.p locus=Potri.006G218850 ID=Potri.006G218850.2.v4.1 annot-version=v4.1
MKKGGPRTALYDLCKKVQWPMPTFDTTETKSRTAIEFGEGPQKRKGFNSYVSKTILNMPSFGVVECEG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G43920 DCL3, ATDCL3 dicer-like 3 (.1.2.3) Potri.006G218850 0 1
AT1G55580 GRAS SCL18, LAS SCARECROW-LIKE 18, Lateral Sup... Potri.001G473200 1.41 0.9377
AT1G55580 GRAS SCL18, LAS SCARECROW-LIKE 18, Lateral Sup... Potri.015G008300 2.44 0.9342
Potri.002G259500 5.47 0.9104
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.006G186000 6.92 0.8944
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.006G186100 8.36 0.8873
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G184900 9.59 0.9028
AT1G55580 GRAS SCL18, LAS SCARECROW-LIKE 18, Lateral Sup... Potri.012G020200 10.09 0.8667 Pt-LAS.3
AT1G11260 ATSTP1, STP1 sugar transporter 1 (.1) Potri.004G101950 12.24 0.8674
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G184100 12.64 0.8872
Potri.019G032401 13.74 0.8369

Potri.006G218850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.