Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G21930 196 / 1e-59 ATHMA8, HMA8, PAA2 ARABIDOPSIS HEAVY METAL ATPASE 8, P-type ATPase of Arabidopsis 2 (.1.2.3) AT4G33520 112 / 7e-30 AtHMAC6, HMA6, PAA1 Arabidopsis thaliana heavy metal ATPase 6, P-type ATP-ase 1 (.1.2.3) AT1G63440 105 / 2e-27 HMA5 heavy metal atpase 5 (.1) AT5G44790 91 / 2e-22 HMA7, RAN1 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1) AT2G19110 54 / 3e-09 ATHMA4, HMA4 ARABIDOPSIS HEAVY METAL ATPASE 4, heavy metal atpase 4 (.1) AT4G30110 52 / 7e-09 ATHMA2, HMA2 ARABIDOPSIS HEAVY METAL ATPASE 2, heavy metal atpase 2 (.1) AT2G07560 52 / 9e-09 AHA6 H\(+\)-ATPase 6, H\(+\)-ATPase 6, H(+)-ATPase 6 (.1) AT3G42640 50 / 3e-08 AHA8 H\(+\)-ATPase 8, H\(+\)-ATPase 8, H(+)-ATPase 8 (.1) AT3G47950 50 / 4e-08 AHA4 H\(+\)-ATPase 4, H\(+\)-ATPase 4, H(+)-ATPase 4 (.1) AT1G17260 49 / 7e-08 AHA10 autoinhibited H\(+\)-ATPase isoform 10, autoinhibited H(+)-ATPase isoform 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G047800 [exp] 224 / 9e-70 AT5G21930 1193 / 0.0 ARABIDOPSIS HEAVY METAL ATPASE 8, P-type ATPase of Arabidopsis 2 (.1.2.3) Potri.003G024000 [exp] 129 / 8e-36 AT4G33520 1078 / 0.0 Arabidopsis thaliana heavy metal ATPase 6, P-type ATP-ase 1 (.1.2.3) Potri.001G205400 [exp] 119 / 2e-32 AT4G33520 1066 / 0.0 Arabidopsis thaliana heavy metal ATPase 6, P-type ATP-ase 1 (.1.2.3) Potri.001G019100 [exp] 95 / 1e-23 AT1G63440 1043 / 0.0 heavy metal atpase 5 (.1) Potri.003G204801 [exp] 90 / 1e-23 AT1G63440 234 / 3e-72 heavy metal atpase 5 (.1) Potri.001G105800 [exp] 91 / 2e-22 AT1G63440 1538 / 0.0 heavy metal atpase 5 (.1) Potri.001G158900 [exp] 91 / 2e-22 AT5G44790 1465 / 0.0 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1) Potri.003G125600 [exp] 91 / 3e-22 AT1G63440 1527 / 0.0 heavy metal atpase 5 (.1) Potri.003G075700 [exp] 89 / 1e-21 AT5G44790 1526 / 0.0 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038070 [exp] 209 / 4e-64 AT5G21930 1146 / 0.0 ARABIDOPSIS HEAVY METAL ATPASE 8, P-type ATPase of Arabidopsis 2 (.1.2.3) Lus10009789 [exp] 173 / 2e-53 AT5G21930 447 / 1e-149 ARABIDOPSIS HEAVY METAL ATPASE 8, P-type ATPase of Arabidopsis 2 (.1.2.3) Lus10023777 [exp] 119 / 2e-32 AT4G33520 1180 / 0.0 Arabidopsis thaliana heavy metal ATPase 6, P-type ATP-ase 1 (.1.2.3) Lus10031840 [exp] 99 / 6e-25 AT5G44790 573 / 0.0 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1) Lus10031273 [exp] 99 / 6e-25 AT1G63440 1040 / 0.0 heavy metal atpase 5 (.1) Lus10008309 [exp] 92 / 1e-22 AT1G63440 1491 / 0.0 heavy metal atpase 5 (.1) Lus10036225 [exp] 91 / 2e-22 AT5G44790 1402 / 0.0 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1) Lus10038364 [exp] 90 / 6e-22 AT5G44790 1441 / 0.0 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1) Lus10025467 [exp] 57 / 1e-10 AT4G30110 1073 / 0.0 ARABIDOPSIS HEAVY METAL ATPASE 2, heavy metal atpase 2 (.1) Lus10006955 [exp] 56 / 3e-10 AT2G19110 1072 / 0.0 ARABIDOPSIS HEAVY METAL ATPASE 4, heavy metal atpase 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G220150.1 pacid=42769390 polypeptide=Potri.006G220150.1.p locus=Potri.006G220150 ID=Potri.006G220150.1.v4.1 annot-version=v4.1 ATGGTAGGTGATGGGATAAATGATGCACCTTCTTTGGCTCTTGCCGATGTTGGGATTGCCATCCAGAATGAAGCTCAAGAAAATGCTGCATCTGATGTTG CATCCATTGTACTTCTTGGCAACAGGCTTTCACAGGTCGTAGATGCCCTGGATCTTTCACGAGCAACAATGGCCAAGGTGTACCAAAATTTATCATGGGC AATTGCGTATAACGTTGTCGCCATTCCTATTGCAGCCGGAGTACTGCTTCCCCAATACGATTTTGCCATGGCTCCTTCACTTTCAGGTGGACTGATGGCT TTGAGCTCGGTATTTGTTGTAACCAACTCATTGCCTCTACAGCTCCATAAGTCGTAA
AA sequence Show only first row Show all	>Potri.006G220150.1 pacid=42769390 polypeptide=Potri.006G220150.1.p locus=Potri.006G220150 ID=Potri.006G220150.1.v4.1 annot-version=v4.1 MVGDGINDAPSLALADVGIAIQNEAQENAASDVASIVLLGNRLSQVVDALDLSRATMAKVYQNLSWAIAYNVVAIPIAAGVLLPQYDFAMAPSLSGGLMA LSSVFVVTNSLPLQLHKS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G21930		ATHMA8, HMA8, P...	ARABIDOPSIS HEAVY METAL ATPASE...		Potri.006G220150 [exp]	0	1
					Potri.008G089401 [exp]	2.44	0.9323
AT4G21160		ZAC, AGD12	ARF-GAP domain 12, Calcium-dep...		Potri.011G098500 [exp]	4.47	0.9064
AT2G37030			SAUR-like auxin-responsive pro...		Potri.016G091500 [exp]	6.24	0.9261
AT4G24520		AR1, ATR1	ARABIDOPSIS CYTOCHROME REDUCTA...		Potri.002G106566 [exp]	6.48	0.9185
AT3G50150			Plant protein of unknown funct...		Potri.016G039200 [exp]	8.36	0.8764
					Potri.004G188432 [exp]	9.79	0.9080
AT1G06820		CCR2, CRTISO	CAROTENOID AND CHLOROPLAST REG...		Potri.006G199600 [exp]	11.22	0.9009
AT5G63700			zinc ion binding;DNA binding (...		Potri.011G078050 [exp]	13.41	0.8777
AT1G33500			unknown protein		Potri.013G095400 [exp]	13.49	0.8855
AT5G05800			unknown protein		Potri.008G074066 [exp]	13.60	0.8750

Compare expression of checked genes

Potri.006G220150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.