Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G06520 80 / 2e-20 PSBX photosystem II subunit X (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G065200 [exp] 107 / 3e-31 AT2G06520 100 / 1e-28 photosystem II subunit X (.1) Potri.006G144000 [exp] 97 / 3e-27 AT2G06520 97 / 6e-27 photosystem II subunit X (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033434 [exp] 75 / 3e-18 AT2G06520 93 / 1e-25 photosystem II subunit X (.1) Lus10025007 [exp] 47 / 2e-07 AT2G06520 72 / 3e-17 photosystem II subunit X (.1) Lus10026458 [exp] 44 / 3e-06 AT2G06520 74 / 3e-18 photosystem II subunit X (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06596 [poplar] [flax] PsbX Photosystem II reaction centre X protein (PsbX)
Representative CDS sequence Show only first row Show all	>Potri.006G222300.1 pacid=42769030 polypeptide=Potri.006G222300.1.p locus=Potri.006G222300 ID=Potri.006G222300.1.v4.1 annot-version=v4.1 ATGGCCTCAGTTTCAATGGCTATGCCACTAGCTTCAGCATCCCAAAAGAGGTTAGAACAGCCACCCAACTCCCAATCCTTCCTTAAGCCACTACCTATAA GGCCATCAATGGAAGTAGGTTTATCTACAAAGTCCAAGTCTAGAGCCAGGCTTGAAGTGCAAGCCTCCTTAAAAGAGAAGGCAGTGACAGGACTAACAGC AGCTGCATTGACAGCTTCAATGGTGATACCAGAGGTAGCAGAAGCAGCGGGGCCTGGCATATCCCCTTCTCTCAAGAATTTCTTGCTCAGCATTGCTGCT GGCGGGGTCGTTGCTGTTGCTATCATTGGAGCTGTTCTTGGAGTTTCCAACTTTGATCCCGTTAAACGAAGCTGA
AA sequence Show only first row Show all	>Potri.006G222300.1 pacid=42769030 polypeptide=Potri.006G222300.1.p locus=Potri.006G222300 ID=Potri.006G222300.1.v4.1 annot-version=v4.1 MASVSMAMPLASASQKRLEQPPNSQSFLKPLPIRPSMEVGLSTKSKSRARLEVQASLKEKAVTGLTAAALTASMVIPEVAEAAGPGISPSLKNFLLSIAA GGVVAVAIIGAVLGVSNFDPVKRS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G06520		PSBX	photosystem II subunit X (.1)		Potri.006G222300 [exp]	0	1
AT5G18660		PCB2, DVR	PALE-GREEN AND CHLOROPHYLL B R...		Potri.008G204900 [exp]	1.73	0.9817
AT5G64040		PSAN, PSI-N	photosystem I reaction center ...		Potri.007G105900 [exp]	2.44	0.9834
AT5G24460			unknown protein		Potri.010G149800 [exp]	2.82	0.9803
AT1G20340		PETE2, DRT112	PLASTOCYANIN 2, DNA-DAMAGE-REP...		Potri.002G016000 [exp]	3.46	0.9824	PETE.2
AT3G25920		RPL15	ribosomal protein L15 (.1)		Potri.008G121100 [exp]	4.89	0.9782
AT1G55670		PSAG	photosystem I subunit G (.1)		Potri.011G168700 [exp]	6.32	0.9798	Pt-PSAG.2
AT4G25080		CHLM	magnesium-protoporphyrin IX me...		Potri.012G106600 [exp]	6.63	0.9759
AT2G34430		LHCB1.4, LHB1B1	light-harvesting chlorophyll-p...		Potri.005G239300 [exp]	6.70	0.9776	LHB1.3,Lhcb1-2
AT1G08380		PSAO	photosystem I subunit O (.1)		Potri.004G199400 [exp]	8.36	0.9780
AT5G22460			alpha/beta-Hydrolases superfam...		Potri.009G164900 [exp]	9.48	0.9578

Compare expression of checked genes

Potri.006G222300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.