Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33060 125 / 3e-35 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G44600 73 / 1e-16 AtCYP71, CYP71 cyclophilin 71, cyclophilin71 (.1) AT2G36130 69 / 3e-16 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT1G01940 60 / 9e-13 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G67530 61 / 3e-12 ATPUB49 plant U-box 49 (.1) AT1G26940 41 / 2e-05 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT1G53720 40 / 4e-05 ATCYP59, CYP59 cyclophilin 59 (.1) AT3G62030 39 / 9e-05 CYP20-3, ROC4 cyclophilin 20-3, rotamase CYP 4 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G061700 [exp] 140 / 8e-41 AT4G33060 548 / 0.0 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.009G146400 [exp] 72 / 2e-16 AT3G44600 1095 / 0.0 cyclophilin 71, cyclophilin71 (.1) Potri.016G075600 [exp] 67 / 2e-15 AT2G36130 278 / 3e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.014G071600 [exp] 60 / 1e-12 AT1G01940 293 / 2e-103 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G149700 [exp] 60 / 2e-12 AT1G01940 293 / 3e-103 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.005G148900 [exp] 55 / 4e-10 AT5G67530 806 / 0.0 plant U-box 49 (.1) Potri.001G251700 [exp] 45 / 1e-06 AT5G58710 313 / 6e-110 rotamase CYP 7 (.1) Potri.005G097500 [exp] 44 / 2e-06 AT1G53720 667 / 0.0 cyclophilin 59 (.1) Potri.008G105800 [exp] 44 / 3e-06 AT3G66654 306 / 2e-106 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024999 [exp] 130 / 8e-37 AT4G33060 344 / 9e-112 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10026441 [exp] 126 / 6e-36 AT4G33060 555 / 0.0 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10006271 [exp] 71 / 8e-16 AT3G44600 1110 / 0.0 cyclophilin 71, cyclophilin71 (.1) Lus10020573 [exp] 71 / 8e-16 AT3G44600 1115 / 0.0 cyclophilin 71, cyclophilin71 (.1) Lus10021335 [exp] 61 / 4e-13 AT2G36130 286 / 1e-100 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10004731 [exp] 63 / 6e-13 AT5G67530 916 / 0.0 plant U-box 49 (.1) Lus10007794 [exp] 62 / 1e-12 AT5G67530 868 / 0.0 plant U-box 49 (.1) Lus10017010 [exp] 60 / 3e-12 AT2G36130 278 / 4e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10009237 [exp] 59 / 4e-12 AT1G01940 317 / 2e-112 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10031772 [exp] 49 / 3e-08 AT1G53720 639 / 0.0 cyclophilin 59 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0475 [poplar] [flax] Cyclophil-like PF00160 [poplar] [flax] Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Representative CDS sequence Show only first row Show all	>Potri.006G225201.1 pacid=42770145 polypeptide=Potri.006G225201.1.p locus=Potri.006G225201 ID=Potri.006G225201.1.v4.1 annot-version=v4.1 ATGCCATCAATTTACGTGTCGGAGCCACCAACAAAAGGCAAAGTAATACTAAACACAACCTACGGTCCTTTAGACATCAAGCTCTGGCCTAAAGAAGCAC CAAAAGCTGTTAGAAACTTCGTTCGGCTCTGCCTCGAAGGTTACTATGATAATAACATCTTTCATCGTATTATTAAAATCTTTCTTGTTCAAGGCGGTGA CCCTACTGGCGCTGGCACAGGTGGTGAAAGTATATATCGAACTGTGTTTGCGGATGAGTACTTCACGTCTGAGATTTAA
AA sequence Show only first row Show all	>Potri.006G225201.1 pacid=42770145 polypeptide=Potri.006G225201.1.p locus=Potri.006G225201 ID=Potri.006G225201.1.v4.1 annot-version=v4.1 MPSIYVSEPPTKGKVILNTTYGPLDIKLWPKEAPKAVRNFVRLCLEGYYDNNIFHRIIKIFLVQGGDPTGAGTGGESIYRTVFADEYFTSEI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G33060			Cyclophilin-like peptidyl-prol...		Potri.006G225201 [exp]	0	1
AT4G33060			Cyclophilin-like peptidyl-prol...		Potri.006G225167 [exp]	1.00	0.9417
AT4G27680			P-loop containing nucleoside t...		Potri.012G017760 [exp]	2.44	0.9198
AT4G27680			P-loop containing nucleoside t...		Potri.012G027101 [exp]	3.87	0.9003
AT4G27680			P-loop containing nucleoside t...		Potri.012G027000 [exp]	7.07	0.8726
AT5G53450		ORG1	OBP3-responsive gene 1 (.1.2)		Potri.015G016375 [exp]	12.44	0.8026
AT1G35670		CPK11, ATCDPK2,...	calcium-dependent protein kina...		Potri.019G050950 [exp]	13.74	0.8448
					Potri.004G011375 [exp]	15.87	0.8156
AT5G52520		PRORS1, OVA6	PROLYL-TRNA SYNTHETASE 1, OVUL...		Potri.004G078866 [exp]	16.18	0.7409
AT5G16715		EMB2247	embryo defective 2247, ATP bin...		Potri.004G090732 [exp]	17.43	0.8412
AT4G39420			unknown protein		Potri.005G086100 [exp]	19.62	0.8341

Compare expression of checked genes

Potri.006G225201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.