Potri.006G228100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11900 308 / 3e-108 Translation initiation factor SUI1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G052900 341 / 3e-121 AT5G11900 289 / 1e-100 Translation initiation factor SUI1 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024986 313 / 7e-110 AT5G11900 326 / 3e-115 Translation initiation factor SUI1 family protein (.1)
Lus10013512 250 / 4e-85 AT5G11900 261 / 1e-89 Translation initiation factor SUI1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01253 SUI1 Translation initiation factor SUI1
Representative CDS sequence
>Potri.006G228100.4 pacid=42769067 polypeptide=Potri.006G228100.4.p locus=Potri.006G228100 ID=Potri.006G228100.4.v4.1 annot-version=v4.1
ATGGCAGAGAAACCTGAGCCAGTGAAAGTGCTATACTGTCCATTATGTTCTCTCCCTGCAGAGTATTGTGAATTCGGTCCTGATTTCGAGAAGTGCAAGC
CTTGGCTCATCATAAACGCCCCTGAACTCTACCCTGATCTCCTTAAAGAGGCTAATGAAAAGGAGGCCGAGAGGGTTTCTGAGCAACTGCAATCAGCTGG
AATTTCCTCAAGTGGTGCTGATGGGGCAGCTTCTTTTGTTCAATCTGGAGTGACATCGTCATCTAAGCAAGAAGAAGTGAAAAGGCTTCCAGGTGGAAAA
ATCAAGAAGAAAGCAAGACAAGAAGTTGTAATCGAAAAGGTTGTTCGCAACAAGCGCAAATGTATCACCATTATTAAAGGATTGGACCTATTTGGTATTA
AATTGAGTGATGCTTCCAAAAAGCTTGGGAAAAAGTTTGCTACTGGAGCATCTGTTGTTAAGGGTCCGACAGAGAAGGAACAGATTGATGTTCAAGGAGA
TATAGCGTATGATATCGTGGAATTTATCACAGAGACTTGGCCTGATGTTCCTGAAACCGCCATTTTCTTCATTGAGGATGGGAAAAAGGTTCCAGCTGCT
TGA
AA sequence
>Potri.006G228100.4 pacid=42769067 polypeptide=Potri.006G228100.4.p locus=Potri.006G228100 ID=Potri.006G228100.4.v4.1 annot-version=v4.1
MAEKPEPVKVLYCPLCSLPAEYCEFGPDFEKCKPWLIINAPELYPDLLKEANEKEAERVSEQLQSAGISSSGADGAASFVQSGVTSSSKQEEVKRLPGGK
IKKKARQEVVIEKVVRNKRKCITIIKGLDLFGIKLSDASKKLGKKFATGASVVKGPTEKEQIDVQGDIAYDIVEFITETWPDVPETAIFFIEDGKKVPAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G11900 Translation initiation factor ... Potri.006G228100 0 1
AT3G07170 Sterile alpha motif (SAM) doma... Potri.002G244700 1.73 0.7910
AT2G03870 EMB2816 EMBRYO DEFECTIVE 2816, Small n... Potri.001G269500 2.44 0.7839
AT4G27040 VPS22 EAP30/Vps36 family protein (.1... Potri.001G424600 3.16 0.7192
AT3G18940 clast3-related (.1) Potri.004G148500 4.00 0.7518
AT1G25520 Uncharacterized protein family... Potri.010G128400 5.91 0.6955
AT5G60860 AtRABA1f RAB GTPase homolog A1F (.1) Potri.001G374000 6.24 0.7543 RAB11.4
AT5G09310 unknown protein Potri.005G063100 7.34 0.7061
AT2G14260 PIP proline iminopeptidase (.1.2) Potri.001G287700 8.48 0.6947
AT1G52600 Peptidase S24/S26A/S26B/S26C f... Potri.003G062800 13.96 0.6745
AT1G06760 winged-helix DNA-binding trans... Potri.010G076800 14.42 0.6597

Potri.006G228100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.