Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29480 212 / 1e-72 Mitochondrial ATP synthase subunit G protein (.1) AT2G19680 211 / 4e-72 Mitochondrial ATP synthase subunit G protein (.1.2) AT4G26210 207 / 2e-70 Mitochondrial ATP synthase subunit G protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G055700 [exp] 239 / 3e-83 AT4G26210 210 / 9e-72 Mitochondrial ATP synthase subunit G protein (.1.2) Potri.006G231900 [exp] 227 / 2e-78 AT4G29480 181 / 3e-60 Mitochondrial ATP synthase subunit G protein (.1) Potri.018G055501 [exp] 135 / 3e-42 AT2G19680 130 / 2e-40 Mitochondrial ATP synthase subunit G protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040553 [exp] 219 / 3e-75 AT4G26210 228 / 9e-79 Mitochondrial ATP synthase subunit G protein (.1.2) Lus10040544 [exp] 219 / 3e-75 AT4G26210 228 / 9e-79 Mitochondrial ATP synthase subunit G protein (.1.2) Lus10007995 [exp] 216 / 2e-73 AT4G26210 225 / 6e-77 Mitochondrial ATP synthase subunit G protein (.1.2) Lus10001771 [exp] 213 / 5e-73 AT4G26210 224 / 3e-77 Mitochondrial ATP synthase subunit G protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04718 [poplar] [flax] ATP-synt_G Mitochondrial ATP synthase g subunit
Representative CDS sequence Show only first row Show all	>Potri.006G232000.4 pacid=42769957 polypeptide=Potri.006G232000.4.p locus=Potri.006G232000 ID=Potri.006G232000.4.v4.1 annot-version=v4.1 ATGGCTTCAAAGCTAGCTCAGTTGCAATCGAAGGCTTGTCATGCCTCAAAGTTTGTGTCTAAGCATGGTGGTGCATATTACAAGCAGTTGTTAGAACAGA ACAAGCAATATATCCAGGATCCACCCACTGTTGAGCAATGCAATCTTTTGTCCAAGCAATTGCTTTACACTCGCCTCGCCAGCATTCCTGTGCGTTATGA AGCATTTTGGAAGGAGCTTGATTATGCTAAGCACCTTTGGAAACACAGGCAGGAGTTGAAGGTTGAGGATGCTGGCATTGCTGCTCTGTTTGGGCTGGAG TGTTTTGCATGGTACTGTGCTGGTGAGATTGTTGGTCGAGGGTTTACTTTCACTGGCTACTATGTCTAA
AA sequence Show only first row Show all	>Potri.006G232000.4 pacid=42769957 polypeptide=Potri.006G232000.4.p locus=Potri.006G232000 ID=Potri.006G232000.4.v4.1 annot-version=v4.1 MASKLAQLQSKACHASKFVSKHGGAYYKQLLEQNKQYIQDPPTVEQCNLLSKQLLYTRLASIPVRYEAFWKELDYAKHLWKHRQELKVEDAGIAALFGLE CFAWYCAGEIVGRGFTFTGYYV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G29480			Mitochondrial ATP synthase sub...		Potri.006G232000 [exp]	0	1
AT2G39960			Microsomal signal peptidase 25...		Potri.010G192700 [exp]	1.41	0.9378
AT3G52730			ubiquinol-cytochrome C reducta...		Potri.004G188700 [exp]	3.16	0.9280
AT2G20820			unknown protein		Potri.013G146000 [exp]	3.74	0.9328
AT2G43640			Signal recognition particle, S...		Potri.013G125200 [exp]	4.89	0.9290
AT3G59600		NRPE8B, NRPD8B,...	RNA polymerase Rpb8 (.1)		Potri.013G072000 [exp]	5.47	0.9187
AT5G14030			translocon-associated protein ...		Potri.017G061900 [exp]	5.65	0.9287
AT4G26210			Mitochondrial ATP synthase sub...		Potri.018G055700 [exp]	5.91	0.9209
AT5G47030			ATPase, F1 complex, delta/epsi...		Potri.003G086100 [exp]	8.12	0.9243
AT3G52300		ATPQ	"ATP synthase D chain, mitocho...		Potri.008G043800 [exp]	8.42	0.8759
AT1G30580			GTP binding (.1)		Potri.011G164000 [exp]	12.92	0.8482

Compare expression of checked genes

Potri.006G232000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.