Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-PRO1.4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29340 216 / 1e-73 PRF4 profilin 4 (.1) AT2G19770 213 / 1e-72 PRF5 profilin 5 (.1) AT2G19760 209 / 3e-71 PRF1, PFN1 profilin 1 (.1) AT4G29350 207 / 1e-70 PRF2, PFN2, PRO2 profilin 2 (.1) AT5G56600 205 / 5e-69 PRF3, PFN3 profilin 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G057600 [exp] 247 / 2e-86 AT4G29340 188 / 5e-63 profilin 4 (.1) Potri.001G190800 [exp] 238 / 2e-82 AT2G19760 196 / 8e-66 profilin 1 (.1) Potri.003G047700 [exp] 233 / 1e-80 AT4G29340 224 / 5e-77 profilin 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034988 [exp] 231 / 9e-80 AT4G29340 219 / 3e-75 profilin 4 (.1) Lus10037591 [exp] 229 / 5e-79 AT2G19770 231 / 6e-80 profilin 5 (.1) Lus10011138 [exp] 229 / 5e-79 AT2G19760 225 / 2e-77 profilin 1 (.1) Lus10012936 [exp] 228 / 8e-79 AT4G29350 223 / 2e-76 profilin 2 (.1) Lus10043040 [exp] 228 / 1e-78 AT5G56600 223 / 1e-76 profilin 3 (.1.2) Lus10006846 [exp] 227 / 4e-78 AT2G19770 229 / 5e-79 profilin 5 (.1) Lus10034989 [exp] 218 / 2e-74 AT4G29340 234 / 6e-81 profilin 4 (.1) Lus10011139 [exp] 218 / 2e-74 AT4G29340 238 / 1e-82 profilin 4 (.1) Lus10043041 [exp] 217 / 4e-74 AT4G29340 239 / 9e-83 profilin 4 (.1) Lus10012935 [exp] 215 / 2e-73 AT4G29340 235 / 2e-81 profilin 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0431 [poplar] [flax] PF PF00235 [poplar] [flax] Profilin Profilin
Representative CDS sequence Show only first row Show all	>Potri.006G235200.3 pacid=42770189 polypeptide=Potri.006G235200.3.p locus=Potri.006G235200 ID=Potri.006G235200.3.v4.1 annot-version=v4.1 ATGTCGTGGCAGCAGTACGTTGATGAGCACTTGATGTGCGATATTGACGGTAATACCCTCACTTCCGCTGCTATCATCGGCCATGACGGTAGCGTCTGGG CTCAAAGCGCTACCTTCCCTCAGTTTACTGCAGAAGAAGTGGCTGCGATTATGAAAGATTTTGATGAACCTGGATCTCTTGCACCAACGGGGTTGTTCCT TGGTGGCGCTAAGTACATGGTGATCCAGGGTGAAGCTGGAGCTGTTATTCGAGGAAAGAAGGGTTCCGGCGGTGTCACCATCAAGAAGACCAATCAGGCA CTTGTCATTGGTGTGTATGACGAGCCTCTAGCTCCCGGTCAATGCAACATGATTGTGGAGAGGCTTGGTGATTATCTATATGACCAGGGTCTTTAG
AA sequence Show only first row Show all	>Potri.006G235200.3 pacid=42770189 polypeptide=Potri.006G235200.3.p locus=Potri.006G235200 ID=Potri.006G235200.3.v4.1 annot-version=v4.1 MSWQQYVDEHLMCDIDGNTLTSAAIIGHDGSVWAQSATFPQFTAEEVAAIMKDFDEPGSLAPTGLFLGGAKYMVIQGEAGAVIRGKKGSGGVTIKKTNQA LVIGVYDEPLAPGQCNMIVERLGDYLYDQGL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G29340		PRF4	profilin 4 (.1)		Potri.006G235200 [exp]	0	1	Pt-PRO1.4
AT5G62575		SDH7B, SDH7	succinate dehydrogenase 7B, su...		Potri.015G072100 [exp]	1.41	0.9543
AT4G15830			ARM repeat superfamily protein...		Potri.010G014200 [exp]	1.73	0.9545
AT5G39510		ZIG1, SGR4, ATV...	SHOOT GRAVITROPSIM 4, VESICLE ...		Potri.004G115700 [exp]	3.60	0.9366
AT3G09740		ATSYP71, SYP71	syntaxin of plants 71 (.1)		Potri.016G088200 [exp]	3.87	0.9493	SYP71.2
AT3G09800			SNARE-like superfamily protein...		Potri.001G197200 [exp]	4.47	0.9479
AT4G35335			Nucleotide-sugar transporter f...		Potri.016G113200 [exp]	5.74	0.9388
AT3G57090		FIS1A, BIGYIN	FISSION 1A, Tetratricopeptide ...		Potri.009G047300 [exp]	6.63	0.9309
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Potri.014G044000 [exp]	6.92	0.9369
AT1G35780			unknown protein		Potri.005G165500 [exp]	7.41	0.9157
AT4G02080		ASAR1, ATSARA1C...	secretion-associated RAS super...		Potri.010G141900 [exp]	7.74	0.9468	Pt-SAR1.2

Compare expression of checked genes

Potri.006G235200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.