Plant FIBer expression Database

Potri.006G236800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32870 180 / 8e-58 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT2G25770 139 / 6e-42 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G237000
[exp]
296 / 8e-104 AT4G32870 180 / 9e-59 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237100
[exp]
240 / 2e-81 AT4G32870 178 / 8e-58 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.018G046100
[exp]
152 / 1e-46 AT2G25770 188 / 1e-61 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.008G063900
[exp]
59 / 4e-11 AT4G32870 80 / 2e-19 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237050
[exp]
0 / 1 AT4G32870 0 / 1 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006042
[exp]
169 / 1e-53 AT4G32870 145 / 3e-45 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10000573
[exp]
162 / 1e-50 AT4G32870 144 / 1e-44 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10005477
[exp]
142 / 6e-43 AT2G25770 172 / 2e-55 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10026898
[exp]
96 / 3e-25 AT2G25770 128 / 2e-38 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10028262
[exp]
58 / 2e-10 AT2G25770 75 / 2e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10040227
[exp]
57 / 1e-09 AT2G25770 75 / 6e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence
>Potri.006G236800.1 pacid=42770671 polypeptide=Potri.006G236800.1.p locus=Potri.006G236800 ID=Potri.006G236800.1.v4.1 annot-version=v4.1
ATGCTTAGATTAGAGAGGTGGAACGCCGTCCCTTTTCATTTATATACACGTGAAGTAGGGCATAGGATGGCTCCCCGTTCATTGATGAAGGCAGTGGATG
AACTTGCAACCTTGAATGAGCCTCTAGGCTTGCCGTCGACAAAAGAAACACAAGGCAAATGGGAAGGCAAGGCCACGGTTGAGCTTAAAGGCCCAACAGC
AGACCAGGTATGGCCTTTCTTGGAGGACTTCTGTAATCTGCAAAAGTGGCTTCCAGGTGTGGATACATGTTACCAAGTTGAGGGTGAGCTAGGACAACCT
GGCTTGGTTCGGTACTGCAGTTCTGGCACAGCATCATCGGATGGGAGCCATGAAGGGAATAAGGTCATCTGGGCCAAAGAGAAGCTAATAATGATCAATC
CAAGTGAACGGTGTCTAAGCTATGAGATCCTTGAAAATAACGCTGGATTCAAGTCATATGTGGCCACCATGAAAGCATTTCCAATCAACGATGGAGATGA
AGATGGAGATGGTCAACATGGGTGCAAGATCGAGTGGTCCTTCATTGCTGATCCAATTGAAGGGTGGCCATTGGAGGATTTCAATTCTTATATCAATTCC
TCTCTCCAGTTCATGGGACAAAAAATGGAACAGGCTGTCCTATCTGGGTAA
AA sequence
>Potri.006G236800.1 pacid=42770671 polypeptide=Potri.006G236800.1.p locus=Potri.006G236800 ID=Potri.006G236800.1.v4.1 annot-version=v4.1
MLRLERWNAVPFHLYTREVGHRMAPRSLMKAVDELATLNEPLGLPSTKETQGKWEGKATVELKGPTADQVWPFLEDFCNLQKWLPGVDTCYQVEGELGQP
GLVRYCSSGTASSDGSHEGNKVIWAKEKLIMINPSERCLSYEILENNAGFKSYVATMKAFPINDGDEDGDGQHGCKIEWSFIADPIEGWPLEDFNSYINS
SLQFMGQKMEQAVLSG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G32870 Polyketide cyclase/dehydrase a... Potri.006G236800
[exp]
0 1
AT2G42390 protein kinase C substrate, he... Potri.019G092100
[exp]
15.09 0.7308
AT4G03960 AtPFA-DSP4 plant and fungi atypical dual-... Potri.011G021100
[exp]
27.98 0.6203
AT3G15095 HCF243 high chlorophyll fluorescence ... Potri.011G097700
[exp]
42.48 0.6566
AT1G24100 UGT74B1 UDP-glucosyl transferase 74B1 ... Potri.015G071900
[exp]
69.33 0.6220
AT5G66880 SNRK2-3, SNRK2.... SUCROSE NONFERMENTING 1 \(SNF1... Potri.005G134400
[exp]
88.99 0.6743
AT2G05630 ATG8D Ubiquitin-like superfamily pro... Potri.014G153800
[exp]
101.32 0.6497
AT1G50420 GRAS SCL-3, SCL3 scarecrow-like 3 (.1) Potri.009G048700
[exp]
125.51 0.6193 Pt-SCL3.1
AT1G55340 Protein of unknown function (D... Potri.018G059200
[exp]
133.69 0.6676
AT1G12710 ATPP2-A12 phloem protein 2-A12 (.1) Potri.003G121900
[exp]
201.99 0.6352

Potri.006G236800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.