Potri.006G237000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32870 180 / 8e-59 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT2G25770 139 / 2e-42 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G236800 297 / 5e-104 AT4G32870 179 / 1e-57 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237100 229 / 1e-77 AT4G32870 178 / 8e-58 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.018G046100 155 / 1e-48 AT2G25770 188 / 1e-61 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.008G063900 62 / 2e-12 AT4G32870 80 / 2e-19 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237050 59 / 1e-11 AT4G32870 0 / 1 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006042 162 / 1e-51 AT4G32870 145 / 3e-45 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10000573 148 / 6e-46 AT4G32870 144 / 1e-44 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10005477 140 / 8e-43 AT2G25770 172 / 2e-55 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10026898 87 / 2e-22 AT2G25770 128 / 2e-38 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10028262 62 / 2e-12 AT2G25770 75 / 2e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10040227 62 / 6e-12 AT2G25770 75 / 6e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence
>Potri.006G237000.1 pacid=42770420 polypeptide=Potri.006G237000.1.p locus=Potri.006G237000 ID=Potri.006G237000.1.v4.1 annot-version=v4.1
ATGACAGAAGAAACACAAGCCAAATGGGAAGGCAAGGCCACGGTTGAGCTAAGAGGCCCAACAGCAGACCAAGTATGGCCTTGCTTGGAGGACTTCTGTA
ATCTACAAAAGTGGCTTCCACGAGTGGATACATGCTACCGAGTTGAGGGTGAGCTAGGACAACCTGGCCTGGTTCGGTGCTGCAATTTTAGCAAAGTACC
ATCGGAAGGGAGTCATGAAGATGAAGAGAATAAGGTCATCTGGGCCAAAGAGAAGCTAATAATGATCAATCCAAGCGAACGGTGTCTAAGCTATGAGATC
CTTGAAAATAACGCTGGATTCAAGTCATATGTGGCCACCATGAAAGTATCGCCAATCAACGATGGAGATGGGGATGGTCAACATGGGTGCACGATCGAGT
GGTCCTTCATAGCTGATCCAATTGAAGGGTGGCCATTGGAGGATTTCAATTCCTATATTAATTCCTCTCTCCAGTTCATGGGGAAAAAAATGGAACGGGA
TGTCCTATCTAGATAA
AA sequence
>Potri.006G237000.1 pacid=42770420 polypeptide=Potri.006G237000.1.p locus=Potri.006G237000 ID=Potri.006G237000.1.v4.1 annot-version=v4.1
MTEETQAKWEGKATVELRGPTADQVWPCLEDFCNLQKWLPRVDTCYRVEGELGQPGLVRCCNFSKVPSEGSHEDEENKVIWAKEKLIMINPSERCLSYEI
LENNAGFKSYVATMKVSPINDGDGDGQHGCTIEWSFIADPIEGWPLEDFNSYINSSLQFMGKKMERDVLSR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G32870 Polyketide cyclase/dehydrase a... Potri.006G237000 0 1
AT3G59470 FAR1_related Far-red impaired responsive (F... Potri.017G029100 9.16 0.5835
AT5G17240 SDG40 SET domain group 40 (.1) Potri.004G081400 13.41 0.6159
AT3G26618 ERF1-3 eukaryotic release factor 1-3 ... Potri.003G159000 14.42 0.5285 ERF1.5
AT3G60410 Protein of unknown function (D... Potri.014G044800 15.62 0.6165
AT5G64010 unknown protein Potri.005G064951 17.74 0.6024
AT3G56680 Single-stranded nucleic acid b... Potri.006G034700 25.19 0.6081
AT4G35940 unknown protein Potri.009G134800 29.12 0.6005
AT2G40830 RHC1A RING-H2 finger C1A (.1.2.3) Potri.006G032100 36.48 0.5880 RHC1.2
AT1G55915 zinc ion binding (.1) Potri.008G009700 61.62 0.5771
AT4G16160 ATOEP16-2, ATOE... Mitochondrial import inner mem... Potri.008G107200 62.92 0.5375

Potri.006G237000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.