Potri.006G237050 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G237000 0 / 1 AT4G32870 180 / 9e-59 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G236800 0 / 1 AT4G32870 179 / 1e-57 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.006G237050.1 pacid=42770073 polypeptide=Potri.006G237050.1.p locus=Potri.006G237050 ID=Potri.006G237050.1.v4.1 annot-version=v4.1
ATGACCACTCAATCTTGCCCCATGTTGAATATCTCCACTGAATATTGGCGACCCTTTAATGGTGGCCACACATGGCTTATCTTTGGCATTATTTTCAAGC
ATCTCATAACTTCGGCACCGTTCAACGGGATCATTCATCACCATCTTCTCATTGGCCCAGCTGACCTCACTGCCGATGTTAGCATTGTGCTGGAAGCCAC
TTATATAGATTACAGAAGGCATCCAAAAATGACCATGTTTGGTCTGCTGCTGAGCCTTTTAGCTCAGCTATGGCCTTCCCTTCCCATCAGGCCCATCAGG
GGGCTGTGTTTTCTGCCATTAAAGAGAGGAGGTGTAGTTTGA
AA sequence
>Potri.006G237050.1 pacid=42770073 polypeptide=Potri.006G237050.1.p locus=Potri.006G237050 ID=Potri.006G237050.1.v4.1 annot-version=v4.1
MTTQSCPMLNISTEYWRPFNGGHTWLIFGIIFKHLITSAPFNGIIHHHLLIGPADLTADVSIVLEATYIDYRRHPKMTMFGLLLSLLAQLWPSLPIRPIR
GLCFLPLKRGGVV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G32870 Polyketide cyclase/dehydrase a... Potri.006G237050 0 1
Potri.016G080101 1.00 0.9071
Potri.010G019550 2.00 0.8738
AT2G27940 RING/U-box superfamily protein... Potri.001G212101 3.87 0.8810
Potri.002G220667 4.89 0.8894
AT5G02190 EMB24, ATASP38,... PROMOTION OF CELL SURVIVAL 1, ... Potri.006G087550 5.29 0.8348
Potri.001G276904 6.70 0.8462
Potri.019G031732 8.06 0.8355
Potri.001G239304 8.94 0.7578
Potri.003G058551 11.83 0.7671
Potri.008G206866 20.73 0.8626

Potri.006G237050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.