Plant FIBer expression Database

Potri.006G237600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11640 295 / 1e-101 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011619
[exp]
315 / 1e-108 AT5G11640 296 / 3e-101 Thioredoxin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.006G237600.1 pacid=42769250 polypeptide=Potri.006G237600.1.p locus=Potri.006G237600 ID=Potri.006G237600.1.v4.1 annot-version=v4.1
ATGAATCCAAATCCGCTATCGGAGCCATATTACCTCCTCCATTTCCTCACTTTCTTCTCTTACCTCATCACTCGCACCTCCGCCACCTCTCTCCTCTCTC
CTCACCTCATTCACCGCCTCTTTTATCGAGAGATTCAAGCGGTTTTGGCGTTTGCCTTGTTAGCTACCTATAAGATTGTGAGAGATGAAACATGGGAAGC
TTTTATTTCCAATATGCTATTTTTCGCTAAGATTTTTCTTGTTGCCATTTCCTTGATAATGGATTACCATTTGGCTCTCTGGTACATGGTGGTGTTTTCA
GTGATATATCTTATAACACAACCACCTGCTTTTGAAGGACTAGGCACGTCGAGTAAATTAACACCACTGCAGTTAGAGACCTTGCTGACAGAAGGGAACA
CATCAAGATTCTGGTTGGTAGAATTCCGTGCTTTGTGCTCCTCTGCTTGCATACATGCTAGTCGGTGCTTTCCAGAGCTCTCAATTACATACTCGAACAA
GAACTTATCATTTGGAATAGTTGATCTTGGACTCTTCCCAAATGCTGCAGAAAAATTTGGAATATCTCTAAGTGGTGGCATGGACCAACTTCCTACGTAT
ATTTTGTTTGAGAATGCAACTGAGGTTACACGCTTTCCAGAGTGGGATTATGAAGCAAAAGCTTCTCATCCTCCTGTAACTAAGAGAGTTCTTTCACGAC
ACTTTGAACTTGATCGGCACCTTCTGGGATATGTAAATTCCTGA
AA sequence
>Potri.006G237600.1 pacid=42769250 polypeptide=Potri.006G237600.1.p locus=Potri.006G237600 ID=Potri.006G237600.1.v4.1 annot-version=v4.1
MNPNPLSEPYYLLHFLTFFSYLITRTSATSLLSPHLIHRLFYREIQAVLAFALLATYKIVRDETWEAFISNMLFFAKIFLVAISLIMDYHLALWYMVVFS
VIYLITQPPAFEGLGTSSKLTPLQLETLLTEGNTSRFWLVEFRALCSSACIHASRCFPELSITYSNKNLSFGIVDLGLFPNAAEKFGISLSGGMDQLPTY
ILFENATEVTRFPEWDYEAKASHPPVTKRVLSRHFELDRHLLGYVNS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G11640 Thioredoxin superfamily protei... Potri.006G237600
[exp]
0 1
AT2G28760 UXS6 UDP-XYL synthase 6 (.1.2.3) Potri.010G207200
[exp]
2.44 0.9623 UXS1.1
AT3G06035 Glycoprotein membrane precurso... Potri.010G033400
[exp]
3.46 0.9602
AT1G26300 BSD domain-containing protein ... Potri.010G137900
[exp]
3.46 0.9537
AT1G10630 ATARFA1F ADP-ribosylation factor A1F (.... Potri.008G100000
[exp]
3.87 0.9545 ARF1.3
AT1G65930 cICDH cytosolic NADP+-dependent isoc... Potri.004G074900
[exp]
5.83 0.9427
AT3G10700 GalAK galacturonic acid kinase (.1) Potri.006G070500
[exp]
5.91 0.9531
AT4G23690 Disease resistance-responsive ... Potri.013G142702
[exp]
6.48 0.9456
AT1G60970 SNARE-like superfamily protein... Potri.003G043200
[exp]
8.12 0.9506
AT2G30395 OFP ATOFP17, OFP17 ovate family protein 17 (.1) Potri.013G155300
[exp]
8.77 0.9476
AT4G15830 ARM repeat superfamily protein... Potri.010G014200
[exp]
9.38 0.9491

Potri.006G237600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.