Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25760 315 / 2e-112 PEX4, UBC21 ubiquitin-conjugating enzyme 21, peroxin4 (.1.2) AT2G16740 121 / 8e-36 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G53300 121 / 1e-35 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT4G27960 120 / 2e-35 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT1G16890 120 / 2e-35 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) AT1G64230 120 / 3e-35 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT1G78870 119 / 5e-35 UBC35 ,UBC13A UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) AT3G08690 119 / 5e-35 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT5G41700 118 / 2e-34 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT1G14400 117 / 4e-34 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G039200 [exp] 324 / 8e-116 AT5G25760 314 / 5e-112 ubiquitin-conjugating enzyme 21, peroxin4 (.1.2) Potri.001G392500 [exp] 121 / 1e-35 AT1G78870 310 / 1e-110 UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) Potri.011G168200 [exp] 119 / 4e-35 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.011G111400 [exp] 119 / 5e-35 AT1G78870 311 / 1e-110 UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) Potri.001G471200 [exp] 119 / 8e-35 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.004G175000 [exp] 119 / 8e-35 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.013G064400 [exp] 117 / 4e-34 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.006G110200 [exp] 117 / 4e-34 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.019G131400 [exp] 117 / 4e-34 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009495 [exp] 277 / 2e-95 AT5G25760 273 / 1e-93 ubiquitin-conjugating enzyme 21, peroxin4 (.1.2) Lus10011695 [exp] 256 / 7e-86 AT5G25760 253 / 3e-84 ubiquitin-conjugating enzyme 21, peroxin4 (.1.2) Lus10017654 [exp] 123 / 2e-36 AT1G16890 311 / 5e-111 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) Lus10033611 [exp] 123 / 2e-36 AT1G16890 311 / 5e-111 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) Lus10030786 [exp] 118 / 2e-34 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10014187 [exp] 118 / 2e-34 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 118 / 2e-34 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10037203 [exp] 118 / 2e-34 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10036727 [exp] 118 / 2e-34 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10027846 [exp] 118 / 2e-34 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.006G240900.2 pacid=42769249 polypeptide=Potri.006G240900.2.p locus=Potri.006G240900 ID=Potri.006G240900.2.v4.1 annot-version=v4.1 ATGCAGGCATCGAGAGCGAGGTTATTAAAGGAATACAAGGAGGTTCAGCGAGAGAAAGTAGCTGATCCGGATATTCAATTAGTTTGTGATGATTCTAACA TTTTTAAATGGACTGCTCTGATCAAGGGACCGTCGGAGACTCCTTTTGAGGGTGGAGTTTTTCAGCTTGCGTTTTCTGTTCCTGAACAGTATCCTTTGCA GCCTCCGCAAGTGCGGTTCTTGACGAAAATATTTCACCCAAATGTGCATTTTAAGACAGGAGAAATATGCCTTGATATATTGAAGAATGCCTGGAGCCCA GCTTGGACTCTTCAGTCTGTTTGTAGGGCTATAATTGCTTTGATGGCCCACCCAGAACCTGATAGCCCTCTAAACTGTGATTCAGGCAATCTTCTACGTT CTGGTGATGTTAGAGGTTATCAATCCATGGCAAGAATGTATACCAGACTTGCAGCCTCGCCAAAGAAAGGATGA
AA sequence Show only first row Show all	>Potri.006G240900.2 pacid=42769249 polypeptide=Potri.006G240900.2.p locus=Potri.006G240900 ID=Potri.006G240900.2.v4.1 annot-version=v4.1 MQASRARLLKEYKEVQREKVADPDIQLVCDDSNIFKWTALIKGPSETPFEGGVFQLAFSVPEQYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSP AWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDVRGYQSMARMYTRLAASPKKG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G25760		PEX4, UBC21	ubiquitin-conjugating enzyme 2...		Potri.006G240900 [exp]	0	1
AT1G25420			Regulator of Vps4 activity in ...		Potri.008G121300 [exp]	1.73	0.7276
AT1G54290			Translation initiation factor ...		Potri.001G418600 [exp]	3.46	0.6994
AT4G35860		ATGB2, AtRABB1b...	GTP-binding 2 (.1.2)		Potri.009G159600 [exp]	3.46	0.7136	Pt-ATGB2.1
AT4G29160		SNF7.1	SNF7 family protein (.1.2.3)		Potri.018G069900 [exp]	5.47	0.7248
AT3G53490			unknown protein		Potri.016G081900 [exp]	6.48	0.6559
AT4G27130			Translation initiation factor ...		Potri.007G122600 [exp]	7.07	0.6763
AT5G35080			unknown protein		Potri.006G061600 [exp]	21.23	0.6323
AT3G59600		NRPE8B, NRPD8B,...	RNA polymerase Rpb8 (.1)		Potri.013G120500 [exp]	21.54	0.6531	Pt-ATRPABC16.2
AT3G46200		ATNUDT9	nudix hydrolase homolog 9 (.1)		Potri.009G026700 [exp]	24.89	0.6370
AT5G20910		AIP2	ABI3-interacting protein 2, RI...		Potri.006G217600 [exp]	27.16	0.6683

Compare expression of checked genes

Potri.006G240900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.