Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56450 399 / 1e-142 PBG1 20S proteasome beta subunit G1 (.1) AT4G31300 54 / 1e-08 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT5G40580 52 / 9e-08 PBB2 20S proteasome beta subunit PBB2 (.1.2.3) AT3G27430 52 / 1e-07 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT4G14800 42 / 0.0002 PBD2 20S proteasome beta subunit D2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G037700 [exp] 483 / 8e-176 AT1G56450 407 / 5e-146 20S proteasome beta subunit G1 (.1) Potri.017G071100 [exp] 49 / 7e-07 AT5G40580 497 / 1e-180 20S proteasome beta subunit PBB2 (.1.2.3) Potri.010G084800 [exp] 49 / 7e-07 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1) Potri.006G077900 [exp] 49 / 1e-06 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.004G066000 [exp] 48 / 2e-06 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.008G155500 [exp] 47 / 3e-06 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036124 [exp] 425 / 9e-153 AT1G56450 426 / 4e-153 20S proteasome beta subunit G1 (.1) Lus10011640 [exp] 424 / 1e-152 AT1G56450 427 / 8e-154 20S proteasome beta subunit G1 (.1) Lus10032102 [exp] 52 / 1e-07 AT3G27430 473 / 6e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10014581 [exp] 52 / 2e-07 AT5G40580 471 / 2e-169 20S proteasome beta subunit PBB2 (.1.2.3) Lus10041194 [exp] 45 / 2e-05 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1) Lus10039351 [exp] 44 / 4e-05 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1) Lus10021909 [exp] 43 / 7e-05 AT3G22630 360 / 2e-128 20S proteasome beta subunit D1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [poplar] [flax] NTN PF00227 [poplar] [flax] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Potri.006G242000.4 pacid=42768541 polypeptide=Potri.006G242000.4.p locus=Potri.006G242000 ID=Potri.006G242000.4.v4.1 annot-version=v4.1 ATGGAGTCTAATTCTGAAACCAAACAGCACACCCTTTTGAGCTCTGACTATGGCATTCAAAGAACCCAGTACCCATACGTGACTGGAACATCTGTTGTTG CTTTGAAATATAAAGATGGGATTTTGATGGCTGCTGATATGGGTGGTTCTTATGGGTCCACGCTTCGATACAAGAGTGTGGAGAGAATTAAGCCTGTCGG GAAGCATTCTATTATCGGTGCCAGTGGAGAAATAAGTGATTTCCAGGAGATTATGCGATATCTCGATGAGCAAGTCCTGAATGACAATATGTGGGATGAC AGAAACTCTTTGGGGCCCAAAGAGATTCACAGCTATTTGACCCGAGTTATGTATAATAGGCGTAACAAGTTTGACCCACTTTGGAATACACTTATTCTCG GTGGTGTGAAAAAAGGACAGAAATTTCTTGGCATGGTCACTATGATAGGAGTAAACTTTGAGGAGAATCATATAGCAACTGGATTTGGAAATCACATGGC ACAGCCATTACTTCGTGCTGAGTGGCATGAGAACTTGACATTCGAAGAAGGCGTTACGTTACTGGAGAAATGCATGCGAGTGCTTCTGTATCGTGATAGA TCTGCTGTCAACAAGTTTCAGATAGCTAAGATTACTGAAGAAGGTGTAACAATTTCTCAGCCTTACGCATTGAAGACATTCTGGGGATACAAGGCATTTG AGAACCCAACTGTTGGTGCTGAAGGATCATGGTAG
AA sequence Show only first row Show all	>Potri.006G242000.4 pacid=42768541 polypeptide=Potri.006G242000.4.p locus=Potri.006G242000 ID=Potri.006G242000.4.v4.1 annot-version=v4.1 MESNSETKQHTLLSSDYGIQRTQYPYVTGTSVVALKYKDGILMAADMGGSYGSTLRYKSVERIKPVGKHSIIGASGEISDFQEIMRYLDEQVLNDNMWDD RNSLGPKEIHSYLTRVMYNRRNKFDPLWNTLILGGVKKGQKFLGMVTMIGVNFEENHIATGFGNHMAQPLLRAEWHENLTFEEGVTLLEKCMRVLLYRDR SAVNKFQIAKITEEGVTISQPYALKTFWGYKAFENPTVGAEGSW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G56450		PBG1	20S proteasome beta subunit G1...		Potri.006G242000 [exp]	0	1
AT3G26340			N-terminal nucleophile aminohy...		Potri.008G177000 [exp]	1.41	0.9013	Pt-PBE1.2
AT1G56450		PBG1	20S proteasome beta subunit G1...		Potri.018G037700 [exp]	2.00	0.8591	Pt-PBG1.1
AT3G27430		PBB1	N-terminal nucleophile aminohy...		Potri.004G066000 [exp]	3.46	0.8530	Pt-PBB1.2
AT1G53750		RPT1A	regulatory particle triple-A 1...		Potri.006G216600 [exp]	5.47	0.8581	RPT1.5
AT4G29040		RPT2A	regulatory particle AAA-ATPase...		Potri.002G252600 [exp]	7.34	0.8173	Pt-RPT2.2
AT5G05780		RPN8A, AE3, ATH...	ASYMMETRIC LEAVES ENHANCER 3, ...		Potri.008G065300 [exp]	8.48	0.8107
AT3G22110		PAC1	20S proteasome alpha subunit C...		Potri.006G008800 [exp]	10.09	0.8312	Pt-PAC1.1
AT3G18940			clast3-related (.1)		Potri.004G148700 [exp]	11.48	0.7732
AT5G10780			unknown protein		Potri.006G266300 [exp]	12.44	0.7733
AT5G40810			Cytochrome C1 family (.1.2)		Potri.009G165000 [exp]	12.64	0.8179

Compare expression of checked genes

Potri.006G242000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.