Potri.006G242600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25630 54 / 8e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G037200 223 / 5e-70 AT5G25630 694 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.018G081700 71 / 8e-15 AT5G21222 643 / 0.0 protein kinase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034924 55 / 5e-09 AT5G21222 599 / 0.0 protein kinase family protein (.1)
Lus10023650 54 / 8e-09 AT5G21222 623 / 0.0 protein kinase family protein (.1)
PFAM info
Representative CDS sequence
>Potri.006G242600.2 pacid=42769162 polypeptide=Potri.006G242600.2.p locus=Potri.006G242600 ID=Potri.006G242600.2.v4.1 annot-version=v4.1
ATGCTATTTGAAGTTCAGCCTGAGAAATCGACCATCTTGCTTGTTGCTGAAGCATGGCATGCTACTGGAATGGCACAAGAGGCAAGTAGAATTCTTGTTA
CGATAAACAGAAAGGAAATGACCAGTCAAAAAGAGACAGTGGAAAAACAAATACCAGTAGGAAACCTAGAGAAACCGCACCGAAATCAAACAGCAGGTGT
CCTGTATTCCAATATCTTGCAGATACCAAGTACAGTTACAAGTGACCATAAAGGGTCTCCTGCAACTCTTAGAAAAGGCAGGATGGTGTTGAGAGAGGAT
GGTTTTCCAGTGGAGTGCTCATGGCTTGCCACAAGAAACATGTCTCTTTCTCATAGTTGTAAATTTGGGTCAAGGTTACCAGTTATTTGCCTCAAGCACA
GCCTGGTCTGTATGGCCAGCTTGCAGTCCTGTACAGCGGTGTTCTTGAACTGGAGGAAAGCCAAATACTGTTTTTGTTTATCATGGCCGTCCTTTCTTCA
TGATGATTTTCATTAA
AA sequence
>Potri.006G242600.2 pacid=42769162 polypeptide=Potri.006G242600.2.p locus=Potri.006G242600 ID=Potri.006G242600.2.v4.1 annot-version=v4.1
MLFEVQPEKSTILLVAEAWHATGMAQEASRILVTINRKEMTSQKETVEKQIPVGNLEKPHRNQTAGVLYSNILQIPSTVTSDHKGSPATLRKGRMVLRED
GFPVECSWLATRNMSLSHSCKFGSRLPVICLKHSLVCMASLQSCTAVFLNWRKAKYCFCLSWPSFLHDDFH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G25630 Tetratricopeptide repeat (TPR)... Potri.006G242600 0 1
AT2G40770 zinc ion binding;DNA binding;h... Potri.019G060126 3.00 0.8872
AT3G58170 ATBET11, ATBS14... ARABIDOPSIS THALIANA BET1P/SFT... Potri.002G041500 4.89 0.8556 Pt-BET11.2
AT5G47540 Mo25 family protein (.1) Potri.016G011300 11.61 0.8414
AT4G14305 Peroxisomal membrane 22 kDa (M... Potri.004G009201 12.48 0.8046
AT2G40770 zinc ion binding;DNA binding;h... Potri.019G060300 18.43 0.8446
AT1G69480 EXS (ERD1/XPR1/SYG1) family pr... Potri.010G165400 20.00 0.8189
AT2G26490 Transducin/WD40 repeat-like su... Potri.002G130400 23.23 0.7831
AT4G36760 ATAPP1 ARABIDOPSIS THALIANA AMINOPEPT... Potri.018G145576 24.89 0.8012
AT4G08460 Protein of unknown function (D... Potri.005G172300 27.71 0.8249
AT1G77680 Ribonuclease II/R family prote... Potri.005G174800 28.61 0.7920

Potri.006G242600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.