Potri.006G242700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G24570 214 / 3e-71 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
AT2G14860 57 / 3e-10 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT5G43140 54 / 4e-09 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT4G33905 52 / 3e-08 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
AT4G14305 42 / 5e-05 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
AT1G52870 42 / 0.0001 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
AT5G19750 41 / 0.0002 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G037100 272 / 5e-94 AT3G24570 289 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Potri.018G081600 209 / 4e-69 AT3G24570 309 / 7e-108 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Potri.001G296400 58 / 2e-10 AT2G14860 300 / 6e-103 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.009G090600 54 / 7e-09 AT4G33905 299 / 1e-102 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.010G068900 48 / 5e-07 AT4G14305 252 / 1e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Potri.001G404600 46 / 3e-06 AT1G52870 438 / 6e-154 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Potri.006G032500 45 / 9e-06 AT5G19750 279 / 8e-94 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Potri.011G123700 44 / 2e-05 AT1G52870 472 / 1e-167 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038626 225 / 2e-75 AT3G24570 273 / 1e-93 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10037900 214 / 1e-70 AT3G24570 246 / 3e-82 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10034922 205 / 2e-67 AT3G24570 330 / 4e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10023648 203 / 1e-66 AT3G24570 330 / 6e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10011679 185 / 8e-60 AT3G24570 249 / 2e-84 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10022130 180 / 9e-58 AT3G24570 256 / 6e-87 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Lus10011424 59 / 2e-10 AT2G14860 288 / 3e-98 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10002118 57 / 5e-10 AT2G14860 292 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10018700 49 / 5e-07 AT5G43140 253 / 2e-83 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Lus10007761 44 / 3e-05 AT5G43140 223 / 1e-70 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family
Representative CDS sequence
>Potri.006G242700.1 pacid=42767963 polypeptide=Potri.006G242702.1.p locus=Potri.006G242700 ID=Potri.006G242700.1.v4.1 annot-version=v4.1
ATGTTGGAGTTGTGGAAATGGTACCAAAATTGCTTGGCTGTGCATCCAGTTAAGAAACAAGTGATTAGCTCAGGGTTTATTTGGGGATTTGGTGATATAG
CTGCAAAATCCATCGCTCACCATACAGCCAAGAAATATCATCAAATCAAGCACTTCACTGCTACTGTCAAAAGATTTTTAATTGATGGGACTGCATATAG
TATGAAGGGTTGCCGATTTATTAGATCACGACTTCTAATGCGTCCAAATTCCTTGCGGTTTGTTGGTGCTAAAGTAGCAATTGATGGGTTCCTCTTTGGA
CCACTGGATCTGCTTGTATTTTTCAGTTACATGGGTTTTGCCACTGGAAAGAGCGTTCCCCAAATCAGGAAAGATTTGAAGAGGGACTTGATACCAGCTT
TTGTTTTGGAAGGAGGTATACGGCCAATTGTTCGAGTTGCGAATTTCCGATTTGTACCTGTGAGGTATCAACTCTTGTATGTCAACTTCTTCTGCTTGTT
GGATAGTTGTTTTCTGTCATGGCTTGAGTAG
AA sequence
>Potri.006G242700.1 pacid=42767963 polypeptide=Potri.006G242702.1.p locus=Potri.006G242700 ID=Potri.006G242700.1.v4.1 annot-version=v4.1
MLELWKWYQNCLAVHPVKKQVISSGFIWGFGDIAAKSIAHHTAKKYHQIKHFTATVKRFLIDGTAYSMKGCRFIRSRLLMRPNSLRFVGAKVAIDGFLFG
PLDLLVFFSYMGFATGKSVPQIRKDLKRDLIPAFVLEGGIRPIVRVANFRFVPVRYQLLYVNFFCLLDSCFLSWLE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G24570 Peroxisomal membrane 22 kDa (M... Potri.006G242700 0 1
Potri.008G020551 3.00 0.6849
AT1G05180 AXR1 AUXIN RESISTANT 1, NAD(P)-bind... Potri.002G229100 3.46 0.6910
AT5G20180 Ribosomal protein L36 (.1.2) Potri.006G069000 7.74 0.6564
AT3G10860 Cytochrome b-c1 complex, subun... Potri.013G159700 19.28 0.6470
Potri.005G098650 19.79 0.6389
AT3G06600 unknown protein Potri.008G103600 23.15 0.6345
AT2G45730 eukaryotic initiation factor 3... Potri.005G238200 30.46 0.5951
AT5G44250 Protein of unknown function DU... Potri.002G127600 34.64 0.5796
AT2G17270 PHT3;3 phosphate transporter 3;3 (.1) Potri.005G098800 35.87 0.5559
AT1G08360 Ribosomal protein L1p/L10e fam... Potri.004G202766 39.24 0.5872

Potri.006G242700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.