Potri.006G243200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11480 422 / 1e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G22870 300 / 2e-101 EMB2001 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G58370 102 / 2e-24 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT1G08410 45 / 6e-05 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G27200 43 / 0.0002 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G037000 496 / 6e-179 AT5G11480 421 / 7e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.007G006300 299 / 4e-101 AT2G22870 434 / 2e-154 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.014G006501 140 / 2e-41 AT2G22870 199 / 2e-65 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.014G007450 100 / 8e-27 AT2G22870 131 / 3e-39 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.019G128000 106 / 1e-25 AT5G58370 461 / 1e-158 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.009G017000 41 / 0.0007 AT1G08410 755 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011673 426 / 7e-151 AT5G11480 418 / 1e-147 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10022126 424 / 2e-150 AT5G11480 418 / 8e-148 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10011703 302 / 2e-102 AT2G22870 427 / 5e-152 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10039653 295 / 2e-99 AT2G22870 426 / 2e-151 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10009919 106 / 2e-25 AT5G58370 473 / 9e-165 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10004103 42 / 0.0004 AT1G08410 756 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10013359 42 / 0.0004 AT1G08410 745 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10028574 41 / 0.0009 AT3G07050 743 / 0.0 nucleostemin-like 1, GTP-binding family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF01926 MMR_HSR1 50S ribosome-binding GTPase
Representative CDS sequence
>Potri.006G243200.1 pacid=42767912 polypeptide=Potri.006G243200.1.p locus=Potri.006G243200 ID=Potri.006G243200.1.v4.1 annot-version=v4.1
ATGGCTCTTTCTCAGCTACCAAAATTCACTTACTGCCCACCTTCTCTTTACAACACCCATATCAACCTCCCTCTCCTCGCCAAGCTCAAACTACCAACCC
TTACAAGACTCAAATCCACACTAACCACAACAGAACCTATACCCATCACCGAAGCCCACAATTTCTTGACACCCCAAGAAGAAACCCAAACCCAATTTTC
ACTTGACAAACTATTTATCCCACCAGACACTGAGGTTTCAATCAATGAGAATAGTGGTCTAAGTGCTAGAATTTTGAAAGGGTCTAATATTGTGTTGAGT
AAGTATGCAAGGGATGCACAGGTTGTTCAAGCTGAGTTTATTAAAAGTAGTGTCAGAACTGAAGATTGTCCTTCTGATGGTTTGCCTGAGTTTGCTCTTG
TTGGAAGGTCTAATGTTGGAAAATCTTCTCTTCTTAATTCTCTTGTTAGAAGAAAGAAACTTGCACTTACCTCCAAAAAACCTGGGAAGACGCAGTGCAT
CAATCATTTTAAGGTCAATGATAGCTGGTACTTGGTGGATTTGCCTGGATATGGGTATGCATCTGCACCTCAGGAACTTCGGACAGATTGGAATAAGTTT
ACTAAAGATTATTTTCTCAATCGCTCAACCTTGGTCTCAGTTTTCCTTCTTATTGATGCTAGTATTCCTGCAAAGAAAATTGATCTTGAATATGCCAGCT
GGCTGGGTCAGAATCAGGTTCCCATGACATTCATTTTCACCAAATGCGACAAGCGGAAGAAGAAAAGGAATGGTGGGAAAAGGCCTGAAGAAAATGTGAA
TGAATTTCAGGAGCTCATACGCGGCTTCTTTGAGACAGCACCTCCTTGGATTATGACCAGCGGTGTTACCAATCAAGGTCGTGATGAGATGCTACTGCAC
ATGGCTCAATTGCGGAACTACTGGCTCAAACACTGA
AA sequence
>Potri.006G243200.1 pacid=42767912 polypeptide=Potri.006G243200.1.p locus=Potri.006G243200 ID=Potri.006G243200.1.v4.1 annot-version=v4.1
MALSQLPKFTYCPPSLYNTHINLPLLAKLKLPTLTRLKSTLTTTEPIPITEAHNFLTPQEETQTQFSLDKLFIPPDTEVSINENSGLSARILKGSNIVLS
KYARDAQVVQAEFIKSSVRTEDCPSDGLPEFALVGRSNVGKSSLLNSLVRRKKLALTSKKPGKTQCINHFKVNDSWYLVDLPGYGYASAPQELRTDWNKF
TKDYFLNRSTLVSVFLLIDASIPAKKIDLEYASWLGQNQVPMTFIFTKCDKRKKKRNGGKRPEENVNEFQELIRGFFETAPPWIMTSGVTNQGRDEMLLH
MAQLRNYWLKH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G11480 P-loop containing nucleoside t... Potri.006G243200 0 1
AT4G37920 unknown protein Potri.007G000400 1.00 0.9880
AT2G04530 CPZ, TRZ2 TRNASE Z 2, Metallo-hydrolase/... Potri.014G160600 2.82 0.9841
AT1G54520 unknown protein Potri.005G049500 4.24 0.9774
AT1G47720 OSB1 Organellar Single-stranded, Pr... Potri.002G045100 4.47 0.9700
AT2G31040 ATP synthase protein I -relate... Potri.014G142200 6.00 0.9754
AT4G02510 TOC86, TOC160, ... TRANSLOCON AT THE OUTER ENVELO... Potri.008G224900 7.48 0.9746
AT5G46580 pentatricopeptide (PPR) repeat... Potri.003G089600 8.48 0.9762
AT2G40690 SFD1, GLY1 SUPPRESSOR OF FATTY ACID DESAT... Potri.013G090900 8.94 0.9737
AT5G57180 CIA2 chloroplast import apparatus 2... Potri.018G142100 9.59 0.9693
AT2G22360 DNAJ heat shock family protein... Potri.005G073900 10.24 0.9751

Potri.006G243200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.