Plant FIBer expression Database

Potri.006G246401 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G25660 94 / 6e-24 EMB2410 embryo defective 2410 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G034700
[exp]
94 / 8e-24 AT2G25660 2951 / 0.0 embryo defective 2410 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022111
[exp]
90 / 3e-24 AT2G25660 264 / 2e-82 embryo defective 2410 (.1)
Lus10001860
[exp]
92 / 3e-23 AT2G25660 1582 / 0.0 embryo defective 2410 (.1)
PFAM info
Representative CDS sequence
>Potri.006G246401.1 pacid=42769893 polypeptide=Potri.006G246401.1.p locus=Potri.006G246401 ID=Potri.006G246401.1.v4.1 annot-version=v4.1
ATGGAGGCTAGTCTACGCCCCAGATTCCTAGTTTACTTTCTGTTGATCCTACAATTAATCCTCTTAAATCTCTGGCCAATATTATTTCATTTGGTTTCAG
AGGTTGAGGCTCAGCTTGGGAATCGTCTTCAGGCCTCCGTTGTAAGGCAGATGAAGGCCTCTGAAATGGCTACGCAATGGACCCTGCTCTACCATCTTAC
CAGCCGTTTGCGAGTGCTCCTACAATCTGCTCCTTCCAAACGGCTCTTTTTTGAATATTATGTTAAACAGTTATTAAAAAATCAATGA
AA sequence
>Potri.006G246401.1 pacid=42769893 polypeptide=Potri.006G246401.1.p locus=Potri.006G246401 ID=Potri.006G246401.1.v4.1 annot-version=v4.1
MEASLRPRFLVYFLLILQLILLNLWPILFHLVSEVEAQLGNRLQASVVRQMKASEMATQWTLLYHLTSRLRVLLQSAPSKRLFFEYYVKQLLKNQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G25660 EMB2410 embryo defective 2410 (.1) Potri.006G246401
[exp]
0 1
AT1G16970 KU70, ATKU70 ARABIDOPSIS THALIANA KU70 HOMO... Potri.006G132501
[exp]
3.87 0.9248
Potri.019G036220
[exp]
14.21 0.9323
Potri.003G063150
[exp]
15.49 0.9122
AT1G09380 nodulin MtN21 /EamA-like trans... Potri.005G006600
[exp]
22.89 0.9258
Potri.019G042001
[exp]
31.43 0.9077
AT1G12060 ATBAG5 BCL-2-associated athanogene 5 ... Potri.003G167500
[exp]
31.46 0.9210
AT2G25730 unknown protein Potri.018G035601
[exp]
32.49 0.9238
AT4G34131 UGT73B3 UDP-glucosyl transferase 73B3 ... Potri.001G303000
[exp]
36.51 0.9027
Potri.011G026450
[exp]
37.14 0.9192
AT4G09190 F-box and associated interacti... Potri.005G254633
[exp]
38.53 0.9187

Potri.006G246401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.