Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11340 280 / 5e-98 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT5G16800 72 / 1e-15 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) AT3G02980 59 / 6e-11 MCC1 MEIOTIC CONTROL OF CROSSOVERS1 (.1) AT2G38130 57 / 1e-10 ATMAK3 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) AT1G03650 47 / 4e-07 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT4G28030 43 / 2e-05 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) AT2G06025 42 / 4e-05 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G032400 [exp] 308 / 2e-109 AT5G11340 270 / 4e-94 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.019G050700 [exp] 68 / 3e-14 AT5G16800 334 / 2e-116 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) Potri.013G079900 [exp] 66 / 2e-13 AT5G16800 346 / 3e-121 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) Potri.001G429200 [exp] 63 / 1e-12 AT2G38130 299 / 6e-105 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Potri.001G435300 [exp] 63 / 1e-12 AT2G38130 299 / 6e-105 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Potri.011G139300 [exp] 62 / 2e-12 AT2G38130 294 / 1e-102 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Potri.001G432400 [exp] 62 / 2e-12 AT2G38130 296 / 4e-104 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Potri.013G134102 [exp] 50 / 4e-08 AT1G03650 242 / 2e-83 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.013G134000 [exp] 50 / 4e-08 AT1G03650 240 / 2e-82 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013120 [exp] 277 / 5e-97 AT5G11340 256 / 8e-89 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10008088 [exp] 261 / 5e-90 AT5G11340 249 / 2e-85 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10013457 [exp] 63 / 3e-12 AT5G16800 337 / 1e-117 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) Lus10041514 [exp] 61 / 1e-11 AT2G38130 287 / 3e-100 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Lus10041016 [exp] 61 / 2e-11 AT5G16800 334 / 1e-116 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) Lus10012579 [exp] 59 / 5e-11 AT2G38130 286 / 7e-100 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Lus10025567 [exp] 48 / 3e-07 AT1G03650 233 / 8e-80 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10021559 [exp] 41 / 0.0002 AT2G06025 244 / 2e-80 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0257 [poplar] [flax] Acetyltrans PF00583 [poplar] [flax] Acetyltransf_1 Acetyltransferase (GNAT) family
Representative CDS sequence Show only first row Show all	>Potri.006G248900.1 pacid=42770579 polypeptide=Potri.006G248900.1.p locus=Potri.006G248900 ID=Potri.006G248900.1.v4.1 annot-version=v4.1 ATGGGGGCAGGGCGTGAAGTATCAATATCCCTAGATGGAGTAAGAGACAAGAACGTGATGCAGCTTAAGAAACTAAACACTGCTCTCTTCCCTGTTCGTT ATAATGACAAATACTACGCCGATGCCCTCGCTTCTGGCGATTTCACCAAGCTAGCATATTACAGTGACATCTGTGTCGGTTCAATTGCTTGCCGACTGGA GAAGAAAGAAGGTGGAGGTCTACGTGTTTACATCATGACATTAGGTGTTTTAGCACCATATCGCGGCCTAGGCATTGGTACAAAGTTGTTGAATCATGTT ATTGATCTCTGCTCAAAGCAACATATTTCTGAGATGTACTTGCACGTGCAGACAAACAATGAAGATGCTATCAGCTTTTACAAGAAATTTGGATTTGAAA TCACAGATACCATCCAGAACTATTACACGAACATTACCCCGCCTGACTGCTATCTTCTTACAAAATTCATCACTGAGACAAAGAATTAA
AA sequence Show only first row Show all	>Potri.006G248900.1 pacid=42770579 polypeptide=Potri.006G248900.1.p locus=Potri.006G248900 ID=Potri.006G248900.1.v4.1 annot-version=v4.1 MGAGREVSISLDGVRDKNVMQLKKLNTALFPVRYNDKYYADALASGDFTKLAYYSDICVGSIACRLEKKEGGGLRVYIMTLGVLAPYRGLGIGTKLLNHV IDLCSKQHISEMYLHVQTNNEDAISFYKKFGFEITDTIQNYYTNITPPDCYLLTKFITETKN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G11340			Acyl-CoA N-acyltransferases (N...		Potri.006G248900 [exp]	0	1
AT4G26780		MGE2, AR192	mitochondrial GrpE 2, Co-chape...		Potri.015G065800 [exp]	1.00	0.9118
AT5G11340			Acyl-CoA N-acyltransferases (N...		Potri.018G032400 [exp]	1.73	0.8828
AT2G29950		ELF4-L1	ELF4-like 1 (.1)		Potri.001G251600 [exp]	2.00	0.9112
AT4G21705			Tetratricopeptide repeat (TPR)...		Potri.004G042500 [exp]	4.47	0.8354
AT1G08125			S-adenosyl-L-methionine-depend...		Potri.009G006800 [exp]	6.32	0.8516
AT1G61580		RPL3B, ARP2	ARABIDOPSIS RIBOSOMAL PROTEIN ...		Potri.003G008300 [exp]	7.34	0.8253
AT1G18450		ATARP4	actin-related protein 4 (.1)		Potri.012G061300 [exp]	8.24	0.8805	ARP901,ARP4.2
AT2G18410			unknown protein		Potri.004G099000 [exp]	9.21	0.8400
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Potri.011G144800 [exp]	11.83	0.8249
AT4G22140		EBS	EARLY BOLTING IN SHORT DAYS, P...		Potri.002G226000 [exp]	13.41	0.8531

Compare expression of checked genes

Potri.006G248900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.