Plant FIBer expression Database

Potri.006G249450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.006G249450.1 pacid=42769509 polypeptide=Potri.006G249450.1.p locus=Potri.006G249450 ID=Potri.006G249450.1.v4.1 annot-version=v4.1
ATGATCCCAAACCTCCTTTGCTGTCTCATACTTTGCCAACTGTGTACCTATAGAATGCTCAACAGAATTGTTGATCCAAGTAATGATCTTTGCATTGTTT
GCTTCCCATGTATCTATCGAGACAATATCTCCTTCTTCAATATTCTTAGGTACCACATAAGTTCCACTAACATATCCCCACATCTTCTTACCCTTAAGAA
AATTTCTCATTACATAGCTCCAATACGAATAGTTCTTCCCATCCAACCTCACACTCACAGACTGAAGCGAATCATCTCTTTCAGTAGCCATAATCAACAA
TCACAAAGAACCAGAATGCAAAAGCAGCGGAAAACAAAATACCAAATTGCAGAAACTGAACAGAGATTGCAGAAACTAAACAAATATCTTCTCAAACTTA
TACGATTACTCCAAAACACAAAACAAATTTGCAGAAACTGA
AA sequence
>Potri.006G249450.1 pacid=42769509 polypeptide=Potri.006G249450.1.p locus=Potri.006G249450 ID=Potri.006G249450.1.v4.1 annot-version=v4.1
MIPNLLCCLILCQLCTYRMLNRIVDPSNDLCIVCFPCIYRDNISFFNILRYHISSTNISPHLLTLKKISHYIAPIRIVLPIQPHTHRLKRIISFSSHNQQ
SQRTRMQKQRKTKYQIAETEQRLQKLNKYLLKLIRLLQNTKQICRN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G21280 unknown protein Potri.006G249450
[exp]
0 1
AT1G05580 ATCHX23 cation/H+ exchanger 23, cation... Potri.007G111400
[exp]
31.74 0.4981 ATCHX23.1
Potri.001G205601
[exp]
32.00 0.5668
AT1G74830 Protein of unknown function, D... Potri.015G068400
[exp]
49.74 0.4768
AT3G51390 DHHC-type zinc finger family p... Potri.005G104800
[exp]
54.11 0.4815
AT1G43760 DNAse I-like superfamily prote... Potri.014G186866
[exp]
80.00 0.4936
Potri.004G021400
[exp]
81.58 0.4409
AT5G50011 CPuORF37 conserved peptide upstream ope... Potri.007G112900
[exp]
92.03 0.4913
AT3G59850 Pectin lyase-like superfamily ... Potri.017G005900
[exp]
99.12 0.4403
AT5G06820 SRF2 STRUBBELIG-receptor family 2 (... Potri.006G190700
[exp]
102.61 0.4159
AT2G27790 RNA-binding (RRM/RBD/RNP motif... Potri.009G167600
[exp]
104.49 0.4779

Potri.006G249450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.