Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30380 61 / 1e-12 EXLB2 Barwin-related endoglucanase (.1) AT2G18660 50 / 2e-08 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1) AT4G17030 40 / 0.0002 ATHEXPBETA3.1, ATEXPR1, AT-EXPR, ATEXLB1 expansin-like B1 (.1) AT4G01630 39 / 0.0004 ATEXP17, ATHEXPALPHA1.13, ATEXPA17 EXPANSIN 17, expansin A17 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G031901 [exp] 216 / 1e-73 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1) Potri.006G155000 [exp] 160 / 2e-51 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1) Potri.018G029100 [exp] 105 / 3e-30 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1) Potri.006G252200 [exp] 100 / 5e-28 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1) Potri.018G098200 [exp] 79 / 2e-19 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1) Potri.003G218300 [exp] 75 / 5e-18 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1) Potri.006G179300 [exp] 66 / 2e-14 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1) Potri.006G176300 [exp] 65 / 3e-14 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1) Potri.018G101600 [exp] 64 / 8e-14 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013118 [exp] 164 / 4e-53 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1) Lus10019444 [exp] 145 / 1e-45 AT2G18660 68 / 3e-15 plant natriuretic peptide A (.1) Lus10033054 [exp] 134 / 5e-41 AT2G18660 56 / 1e-10 plant natriuretic peptide A (.1) Lus10030078 [exp] 95 / 2e-25 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1) Lus10017763 [exp] 82 / 3e-21 ND 35 / 0.001 Lus10042435 [exp] 71 / 3e-16 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1) Lus10019978 [exp] 64 / 9e-14 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1) Lus10026232 [exp] 61 / 3e-12 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1) Lus10020130 [exp] 53 / 3e-09 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1) Lus10026931 [exp] 50 / 7e-08 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0199 [poplar] [flax] DPBB PF03330 [poplar] [flax] DPBB_1 Lytic transglycolase
Representative CDS sequence Show only first row Show all	>Potri.006G249500.2 pacid=42767790 polypeptide=Potri.006G249500.2.p locus=Potri.006G249500 ID=Potri.006G249500.2.v4.1 annot-version=v4.1 ATGTCAATCTTCGGCGCAACCTCTCTCTCTCTACTCATATTGCTCCTGGCAACTCTCTTCCAACTCTCATATGGCGATGTTGGCACTTGTGCCGCCTACA GCGCCCCATATTTACCCACTGCCTGCTATGGAAATTCATCATCACAATTCCCATCAAGCAACATGTTTGCCGCAGCCGGCGAGGGAATATGGGATAACGG TGCAGCCTGCGGGAGACAATACTTGGTGAGATGTATTAGTGCAGCTGTTCCTAGAACTTGCCTTCCGGACCAGATGGTTCAGGTTAGGATTGTGGATCGT GCGCAAACGTCAAGGTCAAGACCTTCATCGGACGGTGCCACCATTGTCCTTGCCACGCCCGCATTTGGTACCATCGCAGACCCTTCAGCGCCATTAATTA ACGTAGAATTTCAACAGGTTTGA
AA sequence Show only first row Show all	>Potri.006G249500.2 pacid=42767790 polypeptide=Potri.006G249500.2.p locus=Potri.006G249500 ID=Potri.006G249500.2.v4.1 annot-version=v4.1 MSIFGATSLSLLILLLATLFQLSYGDVGTCAAYSAPYLPTACYGNSSSQFPSSNMFAAAGEGIWDNGAACGRQYLVRCISAAVPRTCLPDQMVQVRIVDR AQTSRSRPSSDGATIVLATPAFGTIADPSAPLINVEFQQV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Potri.006G249500 [exp]	0	1
AT3G14060			unknown protein		Potri.003G067200 [exp]	1.00	0.8934
AT3G06778			Chaperone DnaJ-domain superfam...		Potri.008G211300 [exp]	4.00	0.8249
AT5G65160		TPR14	tetratricopeptide repeat 14, t...		Potri.005G166300 [exp]	9.48	0.8351
AT1G53708		RTFL9	ROTUNDIFOLIA like 9 (.1)		Potri.002G235101 [exp]	10.24	0.7783
AT3G62020		GLP10	germin-like protein 10 (.1.2)		Potri.004G194600 [exp]	13.49	0.7253	GER2.24
AT2G35910			RING/U-box superfamily protein...		Potri.006G201500 [exp]	19.36	0.7870
AT1G77330			2-oxoglutarate (2OG) and Fe(II...		Potri.005G182700 [exp]	23.49	0.7930	ACO4
					Potri.003G097900 [exp]	38.15	0.7858
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.017G010600 [exp]	43.05	0.8020
AT4G12730		FLA2	FASCICLIN-like arabinogalactan...		Potri.014G168100 [exp]	45.92	0.7416

Compare expression of checked genes

Potri.006G249500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.