Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67250 187 / 5e-62 Proteasome maturation factor UMP1 (.1) AT5G38650 184 / 4e-61 Proteasome maturation factor UMP1 (.1) AT5G38660 185 / 7e-58 APE1 acclimation of photosynthesis to environment (.1.2) AT1G62920 0 / 1 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G111900 [exp] 265 / 9e-93 AT1G67250 187 / 2e-62 Proteasome maturation factor UMP1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003077 [exp] 185 / 3e-61 AT5G38660 193 / 1e-64 acclimation of photosynthesis to environment (.1.2) Lus10034073 [exp] 183 / 2e-60 AT5G38660 197 / 3e-66 acclimation of photosynthesis to environment (.1.2) Lus10005377 [exp] 57 / 1e-11 AT5G38650 54 / 2e-10 Proteasome maturation factor UMP1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05348 [poplar] [flax] UMP1 Proteasome maturation factor UMP1
Representative CDS sequence Show only first row Show all	>Potri.006G249600.1 pacid=42768009 polypeptide=Potri.006G249600.1.p locus=Potri.006G249600 ID=Potri.006G249600.1.v4.1 annot-version=v4.1 ATGGAAGCACCAAAGACAATCGAGCATCAAATTGGAGAAGTCCATGATTCTCTTCGTTTCGGCCTTGATACCAAGAGAGGCGACATCATTGGATCTCACC CTCTTGAATCTGCCTTGCTCTCTGTGGAGAAAAATCAAGAGGACATGAAGAGAATAACCCTTGCAAACGCTTATGGGTCAGCTTTTCTTGTTCAGATGGG TATCGAAAGGCAGATGCTTTCCAGATTCCAGAGGCCACCAGGACCAATTCCATCTTCAATGCTCGGGCTGGAGGCTTTGACCGGAAGTTTGGAAGATTTT GGTTTTGAGGATTATCTGAATGATCCTCGTGAATCTGAAACTTTACGTCCAGTGGACATGCATAGTGGGATGGAAGTTCGTCTTGGAATATCAAAAGGAC CAGCCTGCAAAAGCATCATGTGA
AA sequence Show only first row Show all	>Potri.006G249600.1 pacid=42768009 polypeptide=Potri.006G249600.1.p locus=Potri.006G249600 ID=Potri.006G249600.1.v4.1 annot-version=v4.1 MEAPKTIEHQIGEVHDSLRFGLDTKRGDIIGSHPLESALLSVEKNQEDMKRITLANAYGSAFLVQMGIERQMLSRFQRPPGPIPSSMLGLEALTGSLEDF GFEDYLNDPRESETLRPVDMHSGMEVRLGISKGPACKSIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G67250			Proteasome maturation factor U...		Potri.006G249600 [exp]	0	1
AT1G53750		RPT1A	regulatory particle triple-A 1...		Potri.006G216600 [exp]	1.00	0.9039	RPT1.5
AT1G15120			Ubiquinol-cytochrome C reducta...		Potri.002G069200 [exp]	2.00	0.8912
AT1G21720		PBC1	proteasome beta subunit C1 (.1...		Potri.005G180500 [exp]	4.00	0.8937	Pt-PBC2.1
AT5G23340			RNI-like superfamily protein (...		Potri.005G088800 [exp]	5.19	0.8506
AT3G13235		DDI1	DNA-damage inducible 1, ubiqui...		Potri.001G469300 [exp]	6.00	0.8613
AT5G13430			Ubiquinol-cytochrome C reducta...		Potri.001G067900 [exp]	9.05	0.8410
AT1G01170			Protein of unknown function (D...		Potri.006G051900 [exp]	9.16	0.8569	ATOZI1.1
AT5G19990		ATSUG1, RPT6A	regulatory particle triple-A A...		Potri.008G144100 [exp]	9.48	0.8713	A1.3
AT2G44610		RAB6, AtRABH1b,...	Ras-related small GTP-binding ...		Potri.003G086700 [exp]	9.89	0.8817
AT4G11150		TUFF, EMB2448, ...	embryo defective 2448, vacuola...		Potri.013G051500 [exp]	12.84	0.8927

Compare expression of checked genes

Potri.006G249600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.