Potri.006G250050 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.006G250050.1 pacid=42769189 polypeptide=Potri.006G250050.1.p locus=Potri.006G250050 ID=Potri.006G250050.1.v4.1 annot-version=v4.1
ATGTGGGCCTCAATGGCTTCCAGGAAAATAATACATCTCAACCTCATCTATATCATCGTCGTCATGTGGACGACCGTGCTCAGGCCGGGTATCGAGGGAC
CTCTGTCCTCTACCATTTTGGAATTTCTTTATTTATTGTCCAGAATTCAGATCTATATATGCCCTAGCCATTTGGCTGTTCAAGTGCTGGTTTGGATATC
AGGAATTAAAGAAGAAAGGACTGTCCCAATAACTCCTAGTTCTTCATTTTTTTTCTTCCAAAACCTACTGTATACTCCAATGATTCTGCTAAGTTATTTG
TAA
AA sequence
>Potri.006G250050.1 pacid=42769189 polypeptide=Potri.006G250050.1.p locus=Potri.006G250050 ID=Potri.006G250050.1.v4.1 annot-version=v4.1
MWASMASRKIIHLNLIYIIVVMWTTVLRPGIEGPLSSTILEFLYLLSRIQIYICPSHLAVQVLVWISGIKEERTVPITPSSSFFFFQNLLYTPMILLSYL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G250050 0 1
Potri.006G083850 3.46 0.8481
AT1G59960 NAD(P)-linked oxidoreductase s... Potri.012G039901 8.00 0.8200
Potri.012G031150 14.83 0.8191
AT3G22840 ELIP1 EARLY LIGHT-INDUCABLE PROTEIN,... Potri.008G157900 17.66 0.8160
AT4G21200 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELL... Potri.011G026700 18.97 0.7983
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Potri.017G125600 19.44 0.8118
AT1G64320 myosin heavy chain-related (.1... Potri.003G137300 19.62 0.8018
AT3G22840 ELIP1 EARLY LIGHT-INDUCABLE PROTEIN,... Potri.008G157750 20.39 0.8134
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Potri.018G094800 25.49 0.7999
AT5G24910 ELA1, CYP714A1 EUI-like p450 A1, cytochrome P... Potri.019G064200 31.08 0.7446

Potri.006G250050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.