Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15680 167 / 1e-53 Ran BP2/NZF zinc finger-like superfamily protein (.1) AT5G25490 158 / 5e-50 Ran BP2/NZF zinc finger-like superfamily protein (.1) AT2G26695 113 / 7e-33 Ran BP2/NZF zinc finger-like superfamily protein (.1) AT2G17975 64 / 1e-12 zinc finger (Ran-binding) family protein (.1) AT1G70650 48 / 7e-07 Ran BP2/NZF zinc finger-like superfamily protein (.1.2) AT1G48570 45 / 8e-06 zinc finger (Ran-binding) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G029900 [exp] 230 / 1e-78 AT3G15680 176 / 4e-57 Ran BP2/NZF zinc finger-like superfamily protein (.1) Potri.003G061300 [exp] 186 / 3e-61 AT3G15680 161 / 2e-51 Ran BP2/NZF zinc finger-like superfamily protein (.1) Potri.001G172700 [exp] 180 / 7e-59 AT3G15680 170 / 7e-55 Ran BP2/NZF zinc finger-like superfamily protein (.1) Potri.018G066900 [exp] 126 / 5e-37 AT2G26695 177 / 2e-57 Ran BP2/NZF zinc finger-like superfamily protein (.1) Potri.006G149900 [exp] 118 / 1e-34 AT2G26695 177 / 2e-58 Ran BP2/NZF zinc finger-like superfamily protein (.1) Potri.012G046500 [exp] 51 / 8e-08 AT1G48570 338 / 3e-110 zinc finger (Ran-binding) family protein (.1) Potri.015G038200 [exp] 47 / 2e-06 AT1G48570 335 / 4e-111 zinc finger (Ran-binding) family protein (.1) Potri.005G115100 [exp] 46 / 3e-06 AT2G17975 328 / 4e-113 zinc finger (Ran-binding) family protein (.1) Potri.010G107400 [exp] 42 / 0.0001 AT1G70650 449 / 4e-154 Ran BP2/NZF zinc finger-like superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002896 [exp] 184 / 3e-60 AT3G15680 181 / 9e-59 Ran BP2/NZF zinc finger-like superfamily protein (.1) Lus10002032 [exp] 171 / 5e-55 AT3G15680 182 / 3e-59 Ran BP2/NZF zinc finger-like superfamily protein (.1) Lus10030054 [exp] 114 / 4e-33 AT2G26695 196 / 8e-66 Ran BP2/NZF zinc finger-like superfamily protein (.1) Lus10019433 [exp] 114 / 4e-32 AT2G26695 198 / 2e-65 Ran BP2/NZF zinc finger-like superfamily protein (.1) Lus10043289 [exp] 112 / 2e-31 AT2G26695 198 / 8e-66 Ran BP2/NZF zinc finger-like superfamily protein (.1) Lus10033023 [exp] 111 / 7e-30 AT2G26695 202 / 4e-65 Ran BP2/NZF zinc finger-like superfamily protein (.1) Lus10009681 [exp] 51 / 5e-08 AT1G48570 334 / 3e-111 zinc finger (Ran-binding) family protein (.1) Lus10009049 [exp] 50 / 1e-07 AT1G48570 365 / 7e-123 zinc finger (Ran-binding) family protein (.1) Lus10032790 [exp] 43 / 4e-05 AT1G70650 428 / 2e-146 Ran BP2/NZF zinc finger-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [poplar] [flax] Zn_Beta_Ribbon PF00641 [poplar] [flax] zf-RanBP Zn-finger in Ran binding protein and others
Representative CDS sequence Show only first row Show all	>Potri.006G251300.1 pacid=42770413 polypeptide=Potri.006G251300.1.p locus=Potri.006G251300 ID=Potri.006G251300.1.v4.1 annot-version=v4.1 ATGAGCAGACCAGGAGATTGGAATTGCAGGTCATGCCAGCACTTGAACTTTCAAAGGAGGGACTCATGCCAGCGTTGCGGTGATCCAAGGCCCGGAGAGA GAGATCACTATGGAAGTTTCGGTGGAAGATCATCAGGGGGCTCATTCGGATTTACGGGCCCTGATGTTAGGCCTGGTGATTGGTATTGCACGGCTGGCAA TTGTGGAGCTCACAACTTTGCTAGTCGTTCAAGCTGCTTCAAGTGTGGTGTGTCCAAGGATGAATCCTCTGGTGGTGGACTTGATGCTGACATGTCACGG ATGAGAGGTTATGGCTTCGGCGGAGGCGGAGGCGGAGGCAGTGGCTCTAGCCGTAATTGGAAATCCGGAGACTGGATTTGCACCAGGTCCGGTTGCAACG AGCACAACTTTGCTAGCAGGACTGAATGCTATAGATGCAATGCACCAAGAGAATCTAGCAGCAACAAGTCTTCGTATTAA
AA sequence Show only first row Show all	>Potri.006G251300.1 pacid=42770413 polypeptide=Potri.006G251300.1.p locus=Potri.006G251300 ID=Potri.006G251300.1.v4.1 annot-version=v4.1 MSRPGDWNCRSCQHLNFQRRDSCQRCGDPRPGERDHYGSFGGRSSGGSFGFTGPDVRPGDWYCTAGNCGAHNFASRSSCFKCGVSKDESSGGGLDADMSR MRGYGFGGGGGGGSGSSRNWKSGDWICTRSGCNEHNFASRTECYRCNAPRESSSNKSSY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G15680			Ran BP2/NZF zinc finger-like s...		Potri.006G251300 [exp]	0	1
AT3G18670			Ankyrin repeat family protein ...		Potri.007G110000 [exp]	1.41	0.9690
AT5G18970			AWPM-19-like family protein (....		Potri.008G200000 [exp]	3.16	0.9593
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Potri.001G340500 [exp]	4.24	0.9677
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Potri.001G340400 [exp]	5.47	0.9635
AT3G05620			Plant invertase/pectin methyle...		Potri.005G022700 [exp]	6.92	0.9598
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Potri.001G340200 [exp]	7.34	0.9580
AT3G18670			Ankyrin repeat family protein ...		Potri.005G057900 [exp]	7.93	0.9569
AT1G03670			ankyrin repeat family protein ...		Potri.019G101700 [exp]	9.94	0.9287
					Potri.018G104500 [exp]	10.09	0.9461
AT5G45540			Protein of unknown function (D...		Potri.015G107900 [exp]	10.19	0.9396

Compare expression of checked genes

Potri.006G251300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.