Potri.006G252200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18660 92 / 1e-24 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT4G30380 60 / 2e-12 EXLB2 Barwin-related endoglucanase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G029100 242 / 3e-84 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G179300 106 / 2e-30 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G031901 104 / 1e-29 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.018G101600 102 / 1e-28 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.006G249500 100 / 4e-28 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.006G155000 100 / 4e-28 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Potri.018G098200 95 / 4e-26 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.003G218300 84 / 8e-22 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.006G176300 76 / 1e-18 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030078 159 / 4e-51 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1)
Lus10019444 100 / 4e-28 AT2G18660 68 / 3e-15 plant natriuretic peptide A (.1)
Lus10033054 99 / 2e-27 AT2G18660 56 / 1e-10 plant natriuretic peptide A (.1)
Lus10013118 98 / 6e-27 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1)
Lus10042435 82 / 2e-20 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10019978 67 / 5e-15 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10026232 67 / 1e-14 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10031759 66 / 4e-14 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1)
Lus10026930 55 / 8e-10 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Lus10017763 52 / 1e-09 ND 35 / 0.001
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Potri.006G252200.1 pacid=42770549 polypeptide=Potri.006G252200.1.p locus=Potri.006G252200 ID=Potri.006G252200.1.v4.1 annot-version=v4.1
ATGGTACTCATAGCAATAACAATAATAGTCGTCAGCTTACTCAGCAATGAAATAGGCTTTGTTCTTGGGGACATTGGGACTGCTACTTCTTATGAACCGC
CATATTTACCTACTAAGTGTAATGGGAATAGACAAGATCAATTCCCACCAGGGAACTTGTTTGTTTCTGTGAGTGAAGGTTTGTGGGATAATGGTGCTGC
TTGTGGGAGGCGTTACAGGTTGAGGTGCCTAAGTGGAAATAATAAGCCATGCAAGGATGGGACTATTGACGTTAGGGTGGTGGATTTCTGCAGAAAATCA
CCATGTCCTTCTACTATTCTCTTGTCAAATGATGCCTTTTCTTCTGTATCATACTCCCCATCCGCAAAAATCAACGTTGAATACATCCAGATATGA
AA sequence
>Potri.006G252200.1 pacid=42770549 polypeptide=Potri.006G252200.1.p locus=Potri.006G252200 ID=Potri.006G252200.1.v4.1 annot-version=v4.1
MVLIAITIIVVSLLSNEIGFVLGDIGTATSYEPPYLPTKCNGNRQDQFPPGNLFVSVSEGLWDNGAACGRRYRLRCLSGNNKPCKDGTIDVRVVDFCRKS
PCPSTILLSNDAFSSVSYSPSAKINVEYIQI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Potri.006G252200 0 1
AT5G40990 GLIP1 GDSL lipase 1 (.1) Potri.013G065100 1.00 0.8427
Potri.007G103500 4.58 0.7388
AT5G10830 S-adenosyl-L-methionine-depend... Potri.005G066200 7.74 0.7508
AT4G37530 Peroxidase superfamily protein... Potri.001G329200 10.00 0.7693
AT1G14550 Peroxidase superfamily protein... Potri.010G236890 12.00 0.7386
AT3G12830 SAUR-like auxin-responsive pro... Potri.007G067800 14.83 0.6113
Potri.008G185900 15.32 0.6091
AT5G22900 ATCHX3 cation/H+ exchanger 3, ARABIDO... Potri.006G176800 17.60 0.7296
AT3G23230 AP2_ERF ERF98 Integrase-type DNA-binding sup... Potri.008G166000 17.86 0.7227
AT5G57970 DNA glycosylase superfamily pr... Potri.001G044402 18.11 0.7386

Potri.006G252200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.