Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55550 87 / 2e-21 Concanavalin A-like lectin protein kinase family protein (.1) AT3G08870 82 / 1e-19 Concanavalin A-like lectin protein kinase family protein (.1) AT5G01560 81 / 1e-19 LECRKA4.3 lectin receptor kinase a4.3 (.1) AT1G15530 80 / 6e-19 Concanavalin A-like lectin protein kinase family protein (.1) AT5G06740 79 / 9e-19 Concanavalin A-like lectin protein kinase family protein (.1) AT5G01550 79 / 1e-18 LECRKA4.2 lectin receptor kinase a4.1 (.1) AT2G37710 78 / 2e-18 RLK receptor lectin kinase (.1) AT4G02420 78 / 2e-18 Concanavalin A-like lectin protein kinase family protein (.1) AT5G59260 76 / 2e-17 Concanavalin A-like lectin protein kinase family protein (.1) AT4G02410 76 / 2e-17 Concanavalin A-like lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G028800 [exp] 142 / 3e-41 AT5G06740 371 / 1e-119 Concanavalin A-like lectin protein kinase family protein (.1) Potri.006G193000 [exp] 84 / 3e-20 AT5G06740 688 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.009G035500 [exp] 83 / 4e-20 AT3G53810 598 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.009G035601 [exp] 83 / 4e-20 AT3G45430 498 / 3e-169 Concanavalin A-like lectin protein kinase family protein (.1) Potri.009G035701 [exp] 82 / 9e-20 AT3G53810 585 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.009G035800 [exp] 82 / 1e-19 AT3G53810 540 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.009G036100 [exp] 82 / 1e-19 AT3G53810 617 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.016G045000 [exp] 81 / 2e-19 AT5G06740 702 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.015G083300 [exp] 81 / 3e-19 AT1G15530 759 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004710 [exp] 82 / 4e-20 AT3G55550 486 / 7e-169 Concanavalin A-like lectin protein kinase family protein (.1) Lus10040276 [exp] 82 / 9e-20 AT3G55550 750 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10019879 [exp] 81 / 3e-19 AT1G15530 621 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10014037 [exp] 81 / 3e-19 AT1G15530 807 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10029555 [exp] 80 / 5e-19 AT5G10530 687 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10010867 [exp] 80 / 8e-19 AT3G55550 714 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10024365 [exp] 79 / 8e-19 AT3G55550 711 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10040774 [exp] 78 / 4e-18 AT3G53810 713 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10016507 [exp] 78 / 4e-18 AT3G53810 705 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10001562 [exp] 77 / 5e-18 AT3G53810 655 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.006G252732.1 pacid=42767535 polypeptide=Potri.006G252732.1.p locus=Potri.006G252732 ID=Potri.006G252732.1.v4.1 annot-version=v4.1 ATGCATGCATGTAGACAACTCTCAAAGGCTACTCGCAAATTCTGCGGAGAAATCGTGTTAGGAACTGGTGTATTTGGAAGTGTTTACAAAGGTGTCGTTT CTTCATATCCTCCTATGATCTTAGCTGTAAAAAATATCTCAGAAACTTCAAGACAAGGTGAAAAGGCGTATTTGGCAGAAATATGCACTAGAGGGCATAT GCGGCATAAGAACATAGTGCAACTCCAAGGCTGGTGCCAAGAGCGCCAGCAACTTCTTTTAGTTTAG
AA sequence Show only first row Show all	>Potri.006G252732.1 pacid=42767535 polypeptide=Potri.006G252732.1.p locus=Potri.006G252732 ID=Potri.006G252732.1.v4.1 annot-version=v4.1 MHACRQLSKATRKFCGEIVLGTGVFGSVYKGVVSSYPPMILAVKNISETSRQGEKAYLAEICTRGHMRHKNIVQLQGWCQERQQLLLV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G55550			Concanavalin A-like lectin pro...		Potri.006G252732 [exp]	0	1
AT5G23280	TCP	TCP7	TCP family transcription facto...		Potri.009G009400 [exp]	11.53	0.4918
AT4G27330	NZZ	NZZ, SPL	NOZZLE, sporocyteless (SPL) (....		Potri.001G409000 [exp]	17.32	0.4840
					Potri.006G229050 [exp]	22.91	0.4697
AT1G23000			Heavy metal transport/detoxifi...		Potri.004G091700 [exp]	26.83	0.4697
AT4G34770			SAUR-like auxin-responsive pro...		Potri.009G127400 [exp]	27.74	0.4710
AT5G16920			Fasciclin-like arabinogalactan...		Potri.016G009000 [exp]	37.41	0.4659
AT5G42240		SCPL42	serine carboxypeptidase-like 4...		Potri.005G187700 [exp]	41.59	0.4866
AT5G37820		NIP4;2, NLM5	NODULIN- 26-LIKE MAJOR INTRINS...		Potri.017G128200 [exp]	135.09	0.3902
AT1G28510			Optic atrophy 3 protein (OPA3)...		Potri.019G092900 [exp]	179.89	0.3995
AT4G08690			Sec14p-like phosphatidylinosit...		Potri.005G168100 [exp]	182.53	0.3982

Compare expression of checked genes

Potri.006G252732 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.