Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15370 197 / 3e-66 SNARE-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G193100 [exp] 203 / 2e-68 AT1G15370 263 / 7e-92 SNARE-like superfamily protein (.1) Potri.003G043200 [exp] 39 / 0.0006 AT1G60970 288 / 4e-101 SNARE-like superfamily protein (.1) Potri.001G197200 [exp] 38 / 0.0009 AT3G09800 287 / 1e-100 SNARE-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002016 [exp] 213 / 4e-72 AT1G15370 253 / 7e-88 SNARE-like superfamily protein (.1) Lus10002911 [exp] 213 / 4e-72 AT1G15370 253 / 7e-88 SNARE-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G253700.2 pacid=42767112 polypeptide=Potri.006G253700.2.p locus=Potri.006G253700 ID=Potri.006G253700.2.v4.1 annot-version=v4.1 ATGTTGCTGGCCGTCCTCATCTCCAATTCTGAGGGAAACATTCTTATCGAATTACGGAAAGATCACATTGGAGAGTTTTTTTTAGTTAAATTGGGTGCTG ACAATCTTAAAGGAGCAAGAAATGAAGAGCTCTTTGTTGCTTCCCATAAGTTAGTTTATGTTATTTATACCGTGATTGGAGATGTTTGTCTTTACGTTGT TGGCAAAGATGAGTACAATGAACTTGCTTTGGCTGAAGTGATTTTCATCATCACCGCATCAATCAGGGATGTATGCCAAAAACCTCCAAGTGAGAGGTTG TTTCCTGACAAGTATGGAAGGATTTGTTTATGTCTGGAAGAAATTGTTTGGAAGGGAGTCCTGGAGAACACAGAGAAAGAACGAATCAACAGGCTGATAA GGTTGAAGCCTCCCACCAATATCTGA
AA sequence Show only first row Show all	>Potri.006G253700.2 pacid=42767112 polypeptide=Potri.006G253700.2.p locus=Potri.006G253700 ID=Potri.006G253700.2.v4.1 annot-version=v4.1 MLLAVLISNSEGNILIELRKDHIGEFFLVKLGADNLKGARNEELFVASHKLVYVIYTVIGDVCLYVVGKDEYNELALAEVIFIITASIRDVCQKPPSERL FPDKYGRICLCLEEIVWKGVLENTEKERINRLIRLKPPTNI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G15370			SNARE-like superfamily protein...		Potri.006G253700 [exp]	0	1
AT1G73110			P-loop containing nucleoside t...		Potri.003G187601 [exp]	13.71	0.7196
					Potri.019G040151 [exp]	14.21	0.7512
					Potri.001G394701 [exp]	49.35	0.5583
AT3G11330		PIRL9	plant intracellular ras group-...		Potri.015G083800 [exp]	52.53	0.6061
					Potri.016G130201 [exp]	67.90	0.5787
AT4G32050			neurochondrin family protein (...		Potri.018G022800 [exp]	74.41	0.5954
AT5G16260		ELF9	EARLY FLOWERING 9, RNA binding...		Potri.008G078200 [exp]	78.99	0.5674
AT5G10940		ASG2	ALTERED SEED GERMINATION 2, tr...		Potri.005G158300 [exp]	99.94	0.5516
AT5G27650			Tudor/PWWP/MBT superfamily pro...		Potri.008G209900 [exp]	107.53	0.6140
AT1G43760			DNAse I-like superfamily prote...		Potri.012G063901 [exp]	109.67	0.5311

Compare expression of checked genes

Potri.006G253700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.