Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PSAK.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G30380 176 / 3e-58 PSAK photosystem I subunit K (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G027600 [exp] 191 / 3e-64 AT1G30380 171 / 4e-56 photosystem I subunit K (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007399 [exp] 150 / 1e-47 AT1G30380 174 / 1e-57 photosystem I subunit K (.1) Lus10012086 [exp] 146 / 4e-46 AT1G30380 174 / 3e-57 photosystem I subunit K (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01241 [poplar] [flax] PSI_PSAK Photosystem I psaG / psaK
Representative CDS sequence Show only first row Show all	>Potri.006G254200.1 pacid=42768804 polypeptide=Potri.006G254200.1.p locus=Potri.006G254200 ID=Potri.006G254200.1.v4.1 annot-version=v4.1 ATGGCAGCCACTACCATGATGACTGCTACTGCTCTCCCACAATTCAGTGGCCTGAGACCCTCAGCTGCCCCCGTAAAATCCCTGGCAGCTGTTCAGCCTA CAAGGCGAAAGGGAAATGGAGCCCTGGGTGCTCGTATGGATTTCATTGGTTCGCCCACAAATTTGATAATGGTGACTAGCACAAGCCTCATGCTATTTGC TGGGAGATTTGGGTTAGCCCCATCAGCAAACAGGAAGGCAACTGCAGGATTGAAGCTTGAAGTGAGGGACTCGGGCTTACAAACTGGCGATCCAGCTGGT TTCACTCTTGCTGATACCTTGGCATGTGGGTCTGTTGGTCACATAATTGGTGTTGGAGTTGTTCTTGGTCTTAAGAACATTGGTGCATTGTAA
AA sequence Show only first row Show all	>Potri.006G254200.1 pacid=42768804 polypeptide=Potri.006G254200.1.p locus=Potri.006G254200 ID=Potri.006G254200.1.v4.1 annot-version=v4.1 MAATTMMTATALPQFSGLRPSAAPVKSLAAVQPTRRKGNGALGARMDFIGSPTNLIMVTSTSLMLFAGRFGLAPSANRKATAGLKLEVRDSGLQTGDPAG FTLADTLACGSVGHIIGVGVVLGLKNIGAL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G30380		PSAK	photosystem I subunit K (.1)		Potri.006G254200 [exp]	0	1	PSAK.2
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Potri.001G210000 [exp]	1.00	0.9937	Pt-LHCB6.2,1
AT2G34430		LHCB1.4, LHB1B1	light-harvesting chlorophyll-p...		Potri.005G239200 [exp]	2.00	0.9885	3,Pt-LHB1.1
AT5G24460			unknown protein		Potri.010G149800 [exp]	2.44	0.9832
AT4G10340		LHCB5	light harvesting complex of ph...		Potri.019G063101 [exp]	4.00	0.9849
AT5G12080		ATMSL10, MSL10	mechanosensitive channel of sm...		Potri.006G144100 [exp]	4.58	0.9851
AT1G08380		PSAO	photosystem I subunit O (.1)		Potri.009G160800 [exp]	4.58	0.9830
AT4G21780			unknown protein		Potri.011G136500 [exp]	5.00	0.9835
AT2G34430		LHCB1.4, LHB1B1	light-harvesting chlorophyll-p...		Potri.005G239300 [exp]	6.00	0.9792	LHB1.3,Lhcb1-2
AT2G26500			cytochrome b6f complex subunit...		Potri.009G108700 [exp]	8.94	0.9469
AT1G74730			Protein of unknown function (D...		Potri.012G070600 [exp]	10.48	0.9784

Compare expression of checked genes

Potri.006G254200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.