Potri.006G254300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32340 157 / 2e-47 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G80130 139 / 1e-39 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G20190 135 / 1e-38 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G17940 118 / 4e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G04530 89 / 2e-20 TPR4 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G07280 69 / 3e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
AT2G29670 67 / 2e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G47080 56 / 1e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G068200 155 / 8e-46 AT5G20190 167 / 6e-50 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G130100 151 / 3e-44 AT5G20190 180 / 5e-55 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G130300 150 / 4e-44 AT5G20190 166 / 2e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G140500 121 / 5e-33 AT4G17940 196 / 9e-62 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G256900 106 / 2e-26 AT4G17940 125 / 2e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G172200 90 / 2e-20 AT1G04530 137 / 1e-36 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G065400 82 / 6e-18 AT1G04530 160 / 5e-46 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G044200 71 / 6e-14 AT2G29670 484 / 5e-166 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G250100 71 / 8e-14 AT2G29670 499 / 5e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002013 166 / 5e-50 AT4G32340 152 / 5e-45 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030103 153 / 6e-45 AT5G20190 179 / 1e-54 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002166 149 / 1e-43 AT5G20190 192 / 8e-60 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10043266 124 / 3e-34 AT5G20190 162 / 1e-48 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10019409 122 / 1e-33 AT5G20190 164 / 1e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024949 105 / 7e-26 AT4G17940 125 / 8e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022877 101 / 6e-25 AT4G17940 121 / 5e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014468 97 / 6e-23 AT1G04530 177 / 1e-51 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10023721 97 / 8e-23 AT1G04530 171 / 4e-49 tetratricopeptide repeat 4, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002914 94 / 1e-22 AT4G32340 82 / 2e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.006G254300.1 pacid=42770127 polypeptide=Potri.006G254300.1.p locus=Potri.006G254300 ID=Potri.006G254300.1.v4.1 annot-version=v4.1
ATGCTTCTTAGAAGTACTTCTACACCGGTATTAAGGACACTTGTCTGCCAGTCATCAACAAGCCGGCCAGTGTCCATGTGCCTTCAAAGAACAGCATCAG
AGGCTGATATTAAGCCACTCTACTTGACCAGAGAGAGAATGTTCTCTAAACGTTCTTTCATGTCACCAGTCCTTAAGGAAAAAGAAGAAATGAGCGTTTG
CATAGAAGCAGTCGAGGAGGAGGAGATGGTCTGTGCAGGGGGTGGAAGTGGTGGTATTTGTGGCAGTGGTGGTGGTGGTGGTGGGAGCTGGGACTCGGGT
CATCAGCCTTATGAAAGTGATCATGAGAGCATGAATCTTTATTACCAGAACATGATCAAGGCCTATCCTGGTGATGCTCTTCTTCTTGCAAACTACGCTA
AATTCTTGAAAGAGGTACGAGGTGATGTTGTGAAGGCAGAGGAGTTCTGTGAGAAAGCAATTCTGGCAAATGGAAGAGATGATGGGAATGTTTTGTCAAT
GTACGGAGATCTAATATGGAATAACCACAAGGACAGTAATCGTGCTCAGGCCTACTTTGATCAAGCTGTCAAGTCCTCTCCCGATGACTGTTATGTGCTT
GCTTCTTATGCTCACTTCCTCTGGGATGCTGGTGAAGAAGATGGTGATGAAGAAGAAGAGACCAAGCAGAATGAAATTCAATGTGATAGTTTGCCAACAT
ATAAACAGATATACAATCTTCCTCAAGGATTCCCTCCTTTGGCTGCTGCTTCTTAA
AA sequence
>Potri.006G254300.1 pacid=42770127 polypeptide=Potri.006G254300.1.p locus=Potri.006G254300 ID=Potri.006G254300.1.v4.1 annot-version=v4.1
MLLRSTSTPVLRTLVCQSSTSRPVSMCLQRTASEADIKPLYLTRERMFSKRSFMSPVLKEKEEMSVCIEAVEEEEMVCAGGGSGGICGSGGGGGGSWDSG
HQPYESDHESMNLYYQNMIKAYPGDALLLANYAKFLKEVRGDVVKAEEFCEKAILANGRDDGNVLSMYGDLIWNNHKDSNRAQAYFDQAVKSSPDDCYVL
ASYAHFLWDAGEEDGDEEEETKQNEIQCDSLPTYKQIYNLPQGFPPLAAAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G32340 Tetratricopeptide repeat (TPR)... Potri.006G254300 0 1
AT5G35200 ENTH/ANTH/VHS superfamily prot... Potri.006G065100 3.00 0.8661
AT2G42490 Copper amine oxidase family pr... Potri.015G082900 4.69 0.8416
AT3G29400 ATEXO70E1 exocyst subunit exo70 family p... Potri.017G093650 6.32 0.8426
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Potri.001G382400 7.00 0.8779 Pt-SRG1.2
AT4G02390 ATPARP1, APP POLY\(ADP-RIBOSE\) POLYMERASE ... Potri.014G128000 7.61 0.8690
AT1G33050 unknown protein Potri.011G149601 9.59 0.8197
AT4G25520 SLK1 SEUSS-like 1 (.1) Potri.001G109901 13.56 0.7729
AT5G04930 ALA1 aminophospholipid ATPase 1 (.1... Potri.010G246200 16.43 0.7944
Potri.010G186750 17.43 0.8063
AT5G54590 CRLK1 calcium/calmodulin-regulated r... Potri.004G235700 19.07 0.8338

Potri.006G254300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.