Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G32280 137 / 7e-40 AUX_IAA IAA29 indole-3-acetic acid inducible 29 (.1) AT4G28640 99 / 6e-25 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT4G14550 97 / 1e-24 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) AT3G04730 97 / 1e-24 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1) AT2G22670 98 / 3e-24 AUX_IAA IAA8 indoleacetic acid-induced protein 8 (.1.2.3.4) AT3G23050 96 / 5e-24 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) AT3G17600 92 / 2e-23 AUX_IAA IAA31 indole-3-acetic acid inducible 31 (.1) AT1G15580 92 / 3e-23 AUX_IAA ATAUX2-27, IAA5 AUXIN-INDUCIBLE 2-27, indole-3-acetic acid inducible 5 (.1) AT5G43700 92 / 4e-23 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT3G15540 92 / 1e-22 AUX_IAA MSG2, IAA19 MASSUGU 2, indole-3-acetic acid inducible 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G066600 [exp] 178 / 4e-56 AT4G28640 104 / 3e-27 indole-3-acetic acid inducible 11 (.1.2.3) Potri.018G127800 [exp] 174 / 3e-54 AT1G04550 94 / 2e-23 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) Potri.013G041400 [exp] 105 / 1e-27 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1) Potri.002G044900 [exp] 101 / 4e-26 AT4G14550 286 / 1e-98 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.005G053900 [exp] 100 / 8e-26 AT3G04730 317 / 3e-110 indoleacetic acid-induced protein 16 (.1) Potri.010G078300 [exp] 101 / 9e-26 AT4G14550 319 / 1e-110 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.008G161200 [exp] 100 / 2e-25 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.005G218200 [exp] 97 / 6e-25 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G108000 [exp] 100 / 8e-25 AT5G65670 355 / 4e-122 indole-3-acetic acid inducible 9 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001501 [exp] 105 / 6e-28 AT1G04100 81 / 9e-19 indoleacetic acid-induced protein 10 (.1) Lus10042929 [exp] 104 / 5e-26 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2) Lus10039413 [exp] 100 / 8e-26 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10019241 [exp] 102 / 1e-25 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2) Lus10028222 [exp] 100 / 2e-25 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2) Lus10039488 [exp] 99 / 2e-25 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10024854 [exp] 100 / 4e-25 AT3G04730 221 / 3e-72 indoleacetic acid-induced protein 16 (.1) Lus10014729 [exp] 98 / 7e-25 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10011583 [exp] 99 / 1e-24 AT5G65670 333 / 2e-114 indole-3-acetic acid inducible 9 (.1.2) Lus10023719 [exp] 98 / 4e-24 AT2G33310 223 / 4e-72 auxin-induced protein 13 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF02309 [poplar] [flax] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Potri.006G255200.4 pacid=42769311 polypeptide=Potri.006G255200.4.p locus=Potri.006G255200 ID=Potri.006G255200.4.v4.1 annot-version=v4.1 ATGGAGCTTCAACTAGGTCTTTCCCTTCCAACCTACAATTTTATTGAAAACTTTGACCTGAACAATGGTGGGTTTGAGCCCAAAGATCAGATGCTTGGTT CGAAACCATGGATCAGCTGCGAAGATGGTAATTACTTGGACAACAAACGTAGCTTTGAAGTAGCCTTTGAAAAGAATATCAAAGATGCATCTCAAGAATT GCCTTTACTTTTATGGAGTGGCCAACCAAATGATGAAGATGATTGGAATGGAGAGAAGAAAATCTCTCGTAGCATTAACAAGGATGATGAAGAGGAAAAT CAAGTTGTGGGGTGGCCACCTATTAAGTCATGGAGGAAGAAGGTGCTTCATCACCAGCATCAAGCTGGTCATGTTGTGAATAGTACTAGAATGGCAACAG CTGGGAATTATGAATATGGTACTGGATCAAACTCCAAGTATGTCAAGGTGAAGATGGAAGGAGTAGCAATAACAAGAAAGATTGATTTAAGGCTCTACAA CTCTTACCAGACACTCACAAAATCCTTGATCAGCATGTTTGCAAAATGCAAAAACCTTGAAAAAGATGCTGCACGTTACAGTCTGACATACCAAGACAAA GATGGGGACTGGCTAATTGCAGGAGATGTTCCATGGCAGACTTTCATGGAGTCTGTGCAGCGTTTGAAGATAGTAAGGAATGCTGGTTAA
AA sequence Show only first row Show all	>Potri.006G255200.4 pacid=42769311 polypeptide=Potri.006G255200.4.p locus=Potri.006G255200 ID=Potri.006G255200.4.v4.1 annot-version=v4.1 MELQLGLSLPTYNFIENFDLNNGGFEPKDQMLGSKPWISCEDGNYLDNKRSFEVAFEKNIKDASQELPLLLWSGQPNDEDDWNGEKKISRSINKDDEEEN QVVGWPPIKSWRKKVLHHQHQAGHVVNSTRMATAGNYEYGTGSNSKYVKVKMEGVAITRKIDLRLYNSYQTLTKSLISMFAKCKNLEKDAARYSLTYQDK DGDWLIAGDVPWQTFMESVQRLKIVRNAG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G32280	AUX_IAA	IAA29	indole-3-acetic acid inducible...		Potri.006G255200 [exp]	0	1
AT2G33385		ARPC2B	actin-related protein C2B (.1....		Potri.010G067100 [exp]	3.16	0.8898
AT5G15790			RING/U-box superfamily protein...		Potri.017G100100 [exp]	4.00	0.8669
AT4G25230		RIN2	RPM1 interacting protein 2 (.1...		Potri.001G124000 [exp]	6.08	0.7805
AT3G07510			unknown protein		Potri.002G239500 [exp]	6.92	0.8645
AT3G08500	MYB	ATMYB83	myb domain protein 83 (.1)		Potri.001G267300 [exp]	6.92	0.8426
AT5G63905			unknown protein		Potri.014G015866 [exp]	8.12	0.7972
AT5G52340		ATEXO70A2	exocyst subunit exo70 family p...		Potri.016G071000 [exp]	9.16	0.8382
AT2G03890		UBDKGAMMA7, ATP...	UBIQUITIN-LIKE DOMAIN KINASE G...		Potri.010G137400 [exp]	9.48	0.8107
AT5G25360			unknown protein		Potri.018G130900 [exp]	9.89	0.8207
AT2G21180			unknown protein		Potri.004G167700 [exp]	10.39	0.7676

Compare expression of checked genes

Potri.006G255200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.