Potri.006G255600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32260 214 / 3e-70 PDE334 PIGMENT DEFECTIVE 334, ATPase, F0 complex, subunit B/B', bacterial/chloroplast (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G026500 288 / 2e-99 AT4G32260 218 / 9e-72 PIGMENT DEFECTIVE 334, ATPase, F0 complex, subunit B/B', bacterial/chloroplast (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041039 207 / 2e-67 AT4G32260 220 / 8e-73 PIGMENT DEFECTIVE 334, ATPase, F0 complex, subunit B/B', bacterial/chloroplast (.1)
Lus10006188 206 / 4e-67 AT4G32260 222 / 2e-73 PIGMENT DEFECTIVE 334, ATPase, F0 complex, subunit B/B', bacterial/chloroplast (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0255 ATP_synthase PF00430 ATP-synt_B ATP synthase B/B' CF(0)
Representative CDS sequence
>Potri.006G255600.1 pacid=42767776 polypeptide=Potri.006G255600.1.p locus=Potri.006G255600 ID=Potri.006G255600.1.v4.1 annot-version=v4.1
ATGGCCAACATGATCATGGCCTCTTCCAAACCTCTCATCACCCTCTCCTCCTCTTCCCTCCCCACCAACAACAAACCCAAACTCCAAATCCCACAACTTT
CCTTCCCTAAAATCCTCAAGATCACCAAACCCCAACTCCTATCTCTCTCCACCTCCACCCTCAAATCCCTCTCTCTCATTGCTGCCACTTCCTTAACCTT
CGCACCACCTTCTTTGGCTGAAGAAATAGAAAAGGCTGCACTCTTTGACTTCAACTTAACACTTCCTATAATCATGGTTGAGTTCTTGGTCCTCATGGTT
GCTTTGGACAAAATCTGGTTCACCCCACTTGGTAATTTCATGGATGAGAGAGATTCGGCCATAAAAGAGAAGCTGAGCAGTGTTAAAGATACATCTGAAG
AAGTTAAGCAACTTGAAGAACAGGCTGCTGCTGTTATGAGAGCAGCTAGGGCTGAGATATCGGCTGCATTGAATAAAATGAAGAAGGAAACACAGGGTGA
AGTGGAGCAGAAGTTGGCTGAAGGAAGGAAGAAAATTGAGGCTGACTTGCAAGAAGCACTGGCTAAATTGGAGACTCAGAAAGAGGAGACTATGAAAGCA
CTTGATTCACAAATTGCTGCTCTCAGTGATGGGATTGTTAAGAAGGTGCTTCCTGTTCAATGA
AA sequence
>Potri.006G255600.1 pacid=42767776 polypeptide=Potri.006G255600.1.p locus=Potri.006G255600 ID=Potri.006G255600.1.v4.1 annot-version=v4.1
MANMIMASSKPLITLSSSSLPTNNKPKLQIPQLSFPKILKITKPQLLSLSTSTLKSLSLIAATSLTFAPPSLAEEIEKAALFDFNLTLPIIMVEFLVLMV
ALDKIWFTPLGNFMDERDSAIKEKLSSVKDTSEEVKQLEEQAAAVMRAARAEISAALNKMKKETQGEVEQKLAEGRKKIEADLQEALAKLETQKEETMKA
LDSQIAALSDGIVKKVLPVQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G32260 PDE334 PIGMENT DEFECTIVE 334, ATPase,... Potri.006G255600 0 1
AT4G32260 PDE334 PIGMENT DEFECTIVE 334, ATPase,... Potri.018G026500 1.41 0.9895
AT5G07580 AP2_ERF Integrase-type DNA-binding sup... Potri.001G079600 1.41 0.9839
AT5G64480 unknown protein Potri.001G286200 3.46 0.9813
AT3G02730 TRXF1, ATF1 thioredoxin F-type 1 (.1) Potri.019G054800 4.47 0.9784 PtrcTrxf
AT1G31350 KUF1 KAR-UP F-box 1 (.1) Potri.001G230600 5.91 0.9492
AT5G43750 PnsB5, NDH18 Photosynthetic NDH subcomplex... Potri.010G078800 6.00 0.9795
AT5G49920 Octicosapeptide/Phox/Bem1p fam... Potri.004G224500 7.34 0.9596
AT1G63970 MECPS, ISPF 2C-METHYL-D-ERYTHRITOL 2,4-CYC... Potri.003G132400 7.48 0.9714
AT5G66190 ATLFNR1 ferredoxin-NADP\(+\)-oxidoredu... Potri.007G057200 8.77 0.9748
AT2G33450 Ribosomal L28 family (.1) Potri.010G068500 9.16 0.9766

Potri.006G255600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.