Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) AT3G02190 94 / 8e-28 Ribosomal protein L39 family protein (.1) AT2G25210 86 / 2e-24 Ribosomal protein L39 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G022100 [exp] 103 / 7e-32 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.018G112301 [exp] 103 / 7e-32 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.006G260837 [exp] 103 / 7e-32 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.006G188500 [exp] 103 / 7e-32 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002220 [exp] 97 / 5e-29 ND 99 / 1e-29 Lus10019065 [exp] 97 / 2e-28 AT4G31985 100 / 2e-29 Ribosomal protein L39 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00832 [poplar] [flax] Ribosomal_L39 Ribosomal L39 protein
Representative CDS sequence Show only first row Show all	>Potri.006G260500.5 pacid=42769515 polypeptide=Potri.006G260500.5.p locus=Potri.006G260500 ID=Potri.006G260500.5.v4.1 annot-version=v4.1 ATGCCGTCACACAAGACATTTAGGATCAAGAAGAAACTAGCAAAGAAGATGAGGCAAAACAGGCCTATCCCTCATTGGATTCGCATGAGAACCGATAACA CTATCAGGTACAACGCCAAGCGTAGGCACTGGAGAAGAACTAAGCTTGGATTCTAA
AA sequence Show only first row Show all	>Potri.006G260500.5 pacid=42769515 polypeptide=Potri.006G260500.5.p locus=Potri.006G260500 ID=Potri.006G260500.5.v4.1 annot-version=v4.1 MPSHKTFRIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAKRRHWRRTKLGF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G31985			Ribosomal protein L39 family p...		Potri.006G260500 [exp]	0	1
AT5G22330		ATTIP49A, RIN1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.009G160600 [exp]	7.07	0.6357
AT1G71260		WHY2, ATWHY2	WHIRLY 2 (.1)		Potri.003G048700 [exp]	16.97	0.6313
AT5G59240			Ribosomal protein S8e family p...		Potri.001G360500 [exp]	17.57	0.6162
AT1G61700			RNA polymerases N / 8 kDa subu...		Potri.006G136300 [exp]	22.62	0.5934
AT2G34480			Ribosomal protein L18ae/LX fam...		Potri.004G063300 [exp]	33.85	0.5880	RPL18.6
AT3G10860			Cytochrome b-c1 complex, subun...		Potri.013G159700 [exp]	38.15	0.5807
AT1G08360			Ribosomal protein L1p/L10e fam...		Potri.004G202766 [exp]	41.10	0.5520
AT5G11810			unknown protein		Potri.006G230000 [exp]	64.94	0.5412
AT3G24570			Peroxisomal membrane 22 kDa (M...		Potri.006G242700 [exp]	113.05	0.4917
AT5G09280			Pectin lyase-like superfamily ...		Potri.003G218200 [exp]	119.49	0.4513

Compare expression of checked genes

Potri.006G260500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.