Potri.006G260875 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G045950 68 / 4e-17 ND /
Potri.006G260300 54 / 2e-11 ND /
Potri.006G261022 53 / 4e-11 ND /
Potri.006G260948 37 / 0.0001 ND /
Potri.006G260911 37 / 0.0001 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.006G260875.1 pacid=42767146 polypeptide=Potri.006G260875.1.p locus=Potri.006G260875 ID=Potri.006G260875.1.v4.1 annot-version=v4.1
ATGCCAAGCAATCAAAATTCCGAGCAAGCAGCATGTATTCAAAACAAAGTAACCGTCACGTTCAGCCATCAGGCCCTAATCCTTGTAGTTACCTGCCCGG
AGCAGGCCACTGCAAACCTCCTAAGTGATGCATGTTTCATATATATCATCCATCAGCACACACATGCATGGGATCATATCGATGATGGAAGTGGAAATTA
A
AA sequence
>Potri.006G260875.1 pacid=42767146 polypeptide=Potri.006G260875.1.p locus=Potri.006G260875 ID=Potri.006G260875.1.v4.1 annot-version=v4.1
MPSNQNSEQAACIQNKVTVTFSHQALILVVTCPEQATANLLSDACFIYIIHQHTHAWDHIDDGSGN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G260875 0 1
AT5G48540 receptor-like protein kinase-r... Potri.011G030500 4.24 0.8242
AT1G78340 ATGSTU22 glutathione S-transferase TAU ... Potri.019G130566 4.47 0.8443
AT1G17180 ATGSTU25 glutathione S-transferase TAU ... Potri.019G130433 5.19 0.8401
Potri.010G036000 5.74 0.7769
AT5G48540 receptor-like protein kinase-r... Potri.011G029500 11.95 0.8182
Potri.010G196500 15.49 0.8063
AT4G39955 alpha/beta-Hydrolases superfam... Potri.005G074066 16.49 0.8048
Potri.019G110602 18.97 0.8006
Potri.012G121504 19.89 0.8191
AT5G52600 MYB AtMYB82 myb domain protein 82 (.1) Potri.018G127700 20.49 0.8254

Potri.006G260875 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.