Potri.006G261601 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G31930 79 / 2e-18 Mitochondrial glycoprotein family protein (.1)
AT1G15870 60 / 2e-11 Mitochondrial glycoprotein family protein (.1)
AT1G80720 49 / 1e-07 Mitochondrial glycoprotein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G021600 108 / 1e-29 AT4G31930 259 / 1e-87 Mitochondrial glycoprotein family protein (.1)
Potri.001G047600 62 / 6e-12 AT1G15870 256 / 2e-86 Mitochondrial glycoprotein family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017126 85 / 1e-20 AT4G31930 240 / 3e-80 Mitochondrial glycoprotein family protein (.1)
Lus10018327 83 / 8e-20 AT4G31930 243 / 2e-81 Mitochondrial glycoprotein family protein (.1)
Lus10026060 56 / 9e-10 AT1G15870 263 / 4e-89 Mitochondrial glycoprotein family protein (.1)
PFAM info
Representative CDS sequence
>Potri.006G261601.1 pacid=42770515 polypeptide=Potri.006G261601.1.p locus=Potri.006G261601 ID=Potri.006G261601.1.v4.1 annot-version=v4.1
ATGTTTGATGGATATGTAACTGTTCCAAAACTTGGAGATGTTGCCTCTGATGAAGATTTGCGTCTTCACATCAGTGTGATTGTTGATATTTCCAGAGGGG
ATGGTGGTGAAAAGTTGGAGTTTTTGTGCTCAGCGTGGCCTGATCATTTGGAGATTCAGAAAGTTTACTTGCTTGGGCATAGAAGATGTTGGGTAGGCCT
TTTATGGGACCTGATTTCAGAATCAATGACACTCTCTTCATTTCTGAACAACCGTATTGGACTTGAGTTACAGCGACGCCAATCGCCAATGTTTCAATTG
CTTGGCCGAACAATGTGCTTGACTCAATTCCCAGTTGACACGCTTCCTTTTATCTGCTCATTTTGTATTTTTTCCTCTAATCCTTTACTTTTTGCTTCCA
GTCCTGATATACTTTCAAGGAACAGTCCCTCTACAACCTTTGAAGTGCCCACAAGAGGGACACAACTGAGATTTGGTTTTCAATAA
AA sequence
>Potri.006G261601.1 pacid=42770515 polypeptide=Potri.006G261601.1.p locus=Potri.006G261601 ID=Potri.006G261601.1.v4.1 annot-version=v4.1
MFDGYVTVPKLGDVASDEDLRLHISVIVDISRGDGGEKLEFLCSAWPDHLEIQKVYLLGHRRCWVGLLWDLISESMTLSSFLNNRIGLELQRRQSPMFQL
LGRTMCLTQFPVDTLPFICSFCIFSSNPLLFASSPDILSRNSPSTTFEVPTRGTQLRFGFQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G31930 Mitochondrial glycoprotein fam... Potri.006G261601 0 1
AT1G55750 BSD domain (BTF2-like transcri... Potri.005G061432 1.00 0.8983
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.003G021250 3.00 0.8608
AT3G03740 ATBPM4 BTB-POZ and MATH domain 4 (.1) Potri.009G156500 7.74 0.8543
AT3G56200 Transmembrane amino acid trans... Potri.008G075500 8.48 0.7936
AT1G69480 EXS (ERD1/XPR1/SYG1) family pr... Potri.010G165001 10.90 0.8028
AT1G05180 AXR1 AUXIN RESISTANT 1, NAD(P)-bind... Potri.014G153500 11.48 0.7967 AXR1.3
AT5G41560 unknown protein Potri.001G099200 16.91 0.7854
AT5G42340 PUB15 Plant U-Box 15 (.1) Potri.003G214100 18.97 0.7980
AT1G63770 Peptidase M1 family protein (.... Potri.001G102051 18.97 0.7801
AT1G02335 GL22 germin-like protein subfamily ... Potri.008G084300 19.49 0.7237

Potri.006G261601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.