Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66360 120 / 1e-33 DIM1B adenosine dimethyl transferase 1B, Ribosomal RNA adenine dimethylase family protein (.1.2) AT2G47420 86 / 6e-21 DIM1A adenosine dimethyl transferase 1A, Ribosomal RNA adenine dimethylase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G018900 [exp] 160 / 5e-49 AT5G66360 436 / 8e-153 adenosine dimethyl transferase 1B, Ribosomal RNA adenine dimethylase family protein (.1.2) Potri.014G121200 [exp] 78 / 4e-18 AT2G47420 526 / 0.0 adenosine dimethyl transferase 1A, Ribosomal RNA adenine dimethylase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041797 [exp] 131 / 6e-38 AT5G66360 436 / 8e-153 adenosine dimethyl transferase 1B, Ribosomal RNA adenine dimethylase family protein (.1.2) Lus10034669 [exp] 80 / 1e-18 AT2G47420 527 / 0.0 adenosine dimethyl transferase 1A, Ribosomal RNA adenine dimethylase family protein (.1) Lus10017864 [exp] 79 / 2e-18 AT2G47420 529 / 0.0 adenosine dimethyl transferase 1A, Ribosomal RNA adenine dimethylase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF00398 [poplar] [flax] RrnaAD Ribosomal RNA adenine dimethylase
Representative CDS sequence Show only first row Show all	>Potri.006G264101.1 pacid=42770055 polypeptide=Potri.006G264101.1.p locus=Potri.006G264101 ID=Potri.006G264101.1.v4.1 annot-version=v4.1 ATGGGGATATCTTCACCTCTCTTGGCTAAATTAGTGTATGTGGCGAATCTGTTTCGAAGTGCGACACATCTTCGGAAAGAATTTGCATGGCGGTTGTTGG CGAAGCCTGGTGATTCTGAGTTAATAGGTTGGCTGTCAAGAGATTTTCTTCCTGCTCCCAAAGTTGATTCTTCGGTGGTTATCATTCAGCCAAAAGATCA GATTCCTGGTGTGAATCTTGATGAATGGTGTGAGTTCACGAAAACGTGTTTTGAGAAGAAGAATAAGACCTTGGGGGTAGCATTTAAGCAGAAGGTGATA GAGCTATTCGGGTTATCAAAAATGGCAAGCTCTAACAGAGAAGAAATGAACAGGAACTGA
AA sequence Show only first row Show all	>Potri.006G264101.1 pacid=42770055 polypeptide=Potri.006G264101.1.p locus=Potri.006G264101 ID=Potri.006G264101.1.v4.1 annot-version=v4.1 MGISSPLLAKLVYVANLFRSATHLRKEFAWRLLAKPGDSELIGWLSRDFLPAPKVDSSVVIIQPKDQIPGVNLDEWCEFTKTCFEKKNKTLGVAFKQKVI ELFGLSKMASSNREEMNRN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G66360		DIM1B	adenosine dimethyl transferase...		Potri.006G264101 [exp]	0	1
AT2G05755			Nodulin MtN21 /EamA-like trans...		Potri.014G157700 [exp]	3.74	0.8301
AT2G40316			unknown protein		Potri.008G073200 [exp]	3.87	0.8541
AT3G28610			P-loop containing nucleoside t...		Potri.012G072300 [exp]	5.00	0.8514
AT5G12870	MYB	ATMYB46	myb domain protein 46 (.1)		Potri.001G258700 [exp]	6.00	0.8599
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Potri.014G041532 [exp]	9.84	0.7478
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.001G129400 [exp]	10.58	0.8468	CYP89A27P
AT1G69480			EXS (ERD1/XPR1/SYG1) family pr...		Potri.010G165400 [exp]	12.48	0.8334
AT3G09780		CCR1, ATCRR1	CRINKLY4 related 1 (.1)		Potri.006G128400 [exp]	13.41	0.7961
AT3G19720		DRP5B, ARC5	Dynamin related protein 5B, AC...		Potri.018G027001 [exp]	13.63	0.8492
AT3G10480	NAC	ANAC050	NAC domain containing protein ...		Potri.013G079700 [exp]	14.28	0.7792	NAC152

Compare expression of checked genes

Potri.006G264101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.