Potri.006G265400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G25080 343 / 4e-121 ATGPX1 glutathione peroxidase 1 (.1)
AT4G31870 338 / 6e-119 ATGPX7 glutathione peroxidase 7 (.1)
AT4G11600 255 / 3e-86 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1)
AT2G43350 240 / 1e-80 ATGPX3 glutathione peroxidase 3 (.1.2)
AT2G31570 238 / 2e-80 ATGPX2 glutathione peroxidase 2 (.1)
AT3G63080 217 / 5e-72 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1)
AT1G63460 215 / 2e-71 ATGPX8 glutathione peroxidase 8 (.1)
AT2G48150 212 / 4e-70 ATGPX4 glutathione peroxidase 4 (.1)
AT3G26060 41 / 0.0002 ATPRXQ ,ATPRX Q peroxiredoxin Q, Thioredoxin superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G105200 253 / 2e-86 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1)
Potri.007G126600 254 / 3e-86 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1)
Potri.003G126100 251 / 1e-84 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1)
Potri.001G105100 231 / 3e-77 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1)
Potri.014G138800 221 / 1e-73 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1)
Potri.018G017500 219 / 1e-72 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026887 361 / 1e-127 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1)
Lus10042418 360 / 2e-127 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1)
Lus10003421 344 / 1e-119 AT4G31870 319 / 9e-110 glutathione peroxidase 7 (.1)
Lus10008499 253 / 2e-85 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1)
Lus10008022 248 / 4e-84 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1)
Lus10008537 247 / 7e-84 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1)
Lus10027021 244 / 1e-82 AT2G31570 266 / 2e-92 glutathione peroxidase 2 (.1)
Lus10029651 221 / 1e-73 AT2G48150 274 / 2e-95 glutathione peroxidase 4 (.1)
Lus10008023 219 / 2e-71 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1)
Lus10000603 214 / 4e-71 AT4G11600 256 / 9e-88 glutathione peroxidase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00578 AhpC-TSA AhpC/TSA family
Representative CDS sequence
>Potri.006G265400.1 pacid=42768204 polypeptide=Potri.006G265400.1.p locus=Potri.006G265400 ID=Potri.006G265400.1.v4.1 annot-version=v4.1
ATGGCTTCCTTACCTTTCTCCTGTTCATCCGTACCGGGTTTGAAAATCCATCCAAACCCTACAAAAATGGCTTTCTTTGTCACTTCCATCAAGTCCTCAC
TTGGGCCTTCCAAATCTGCTTTTTTGCAACGTGGGTTTTCTTTACAGTCTCCAAATCTTCCTGGGTTTGCCTCTAAAGCCCGGTCCTTTGGTGTTTTTGC
TAGAGCTGCTACAGAGAAATCTGTTCATGACTTCACTGTTAAGGATATTAATGGGAAGGATGTTGCTCTTAGCAAATTTAAGGGGAAAGCTCTCTTGATT
GTTAATGTCGCTTCGAAATGTGGTTTGACATCATCAAATTATTCGGAACTCACACACATATACGAGAAGTACAAAACTCAAGGCTTCGAAATTCTGGCTT
TTCCTTGCAATCAGTTTGGTGGGCAAGAACCTGGATCAAACCCTGAGATTAAACAATTTGCTTGTACCAGGTACAAAGCAGAATTTCCAATATTTGATAA
GGTTGATGTGAATGGACCAAGTACAGCTCCAGTCTATCAGTTTCTGAAATCAAGTGCTGGAGGATTTTTAGGTGATTTGATCAAGTGGAACTTTGAGAAG
TTCTTGGTGGACAAGAATGGCAAGGTTGTGGAGAGATATCAACCAACAACATCACCTTTCCAAATCGAGAAGGACATTCAGAAGCTCCTCGCGGCATGA
AA sequence
>Potri.006G265400.1 pacid=42768204 polypeptide=Potri.006G265400.1.p locus=Potri.006G265400 ID=Potri.006G265400.1.v4.1 annot-version=v4.1
MASLPFSCSSVPGLKIHPNPTKMAFFVTSIKSSLGPSKSAFLQRGFSLQSPNLPGFASKARSFGVFARAATEKSVHDFTVKDINGKDVALSKFKGKALLI
VNVASKCGLTSSNYSELTHIYEKYKTQGFEILAFPCNQFGGQEPGSNPEIKQFACTRYKAEFPIFDKVDVNGPSTAPVYQFLKSSAGGFLGDLIKWNFEK
FLVDKNGKVVERYQPTTSPFQIEKDIQKLLAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G25080 ATGPX1 glutathione peroxidase 1 (.1) Potri.006G265400 0 1
AT5G30510 ARRPS1, RPS1 ribosomal protein S1 (.1) Potri.008G101100 1.73 0.9886
AT4G18370 DEGP5, DEG5, HH... PROTEASE HHOA PRECUSOR, DEGP p... Potri.011G083300 4.00 0.9806 Pt-HHOA.1
AT1G59960 NAD(P)-linked oxidoreductase s... Potri.005G097000 5.47 0.9725
AT1G67280 Glyoxalase/Bleomycin resistanc... Potri.006G160600 6.32 0.9697
AT2G33800 EMB3113 EMBRYO DEFECTIVE 3113, Ribosom... Potri.004G045700 6.48 0.9783
AT1G12770 ISE1, EMB1586 INCREASED SIZE EXCLUSION LIMIT... Potri.003G123600 8.24 0.9665
AT3G63140 CSP41A chloroplast stem-loop binding ... Potri.005G209500 8.94 0.9761
AT5G01920 STN8 State transition 8, Protein ki... Potri.006G109700 9.48 0.9725
AT4G35770 ATSEN1, DIN1, S... SENESCENCE ASSOCIATED GENE 1, ... Potri.005G106400 11.57 0.9452
AT1G52827 ATCDT1 cadmium tolerance 1 (.1) Potri.001G177366 13.30 0.9564

Potri.006G265400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.