Potri.006G265801 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.006G265801.1 pacid=42768092 polypeptide=Potri.006G265801.1.p locus=Potri.006G265801 ID=Potri.006G265801.1.v4.1 annot-version=v4.1
ATGCTGGCCGTTCCAATCCATATATTTTCCATCCATCTAATAATTAACGTTAGGTGGTGGCCTGATTTCGAGTTTAAAATTTGCTTTGGAACATTGTTGG
GGCCGAGTAGATTCAGGAGGAACCATATGGTGGGCTACGAAGGCTGGCCACTAGTTATTAACTTTGTCAGGTTGCCTCCATGCAAGGACAAAACTATCCA
GGACTTTATCTCCTCTCTATTTACCGCTTTATTTTTTTATATTTTTATTGTTGAAACGCAGATTACACCGCTTGGAGGATTCCTCTTACCAGCAACCGAT
AGCAAGTTGCACGACAAGACATGCCCACCTAATTAA
AA sequence
>Potri.006G265801.1 pacid=42768092 polypeptide=Potri.006G265801.1.p locus=Potri.006G265801 ID=Potri.006G265801.1.v4.1 annot-version=v4.1
MLAVPIHIFSIHLIINVRWWPDFEFKICFGTLLGPSRFRRNHMVGYEGWPLVINFVRLPPCKDKTIQDFISSLFTALFFYIFIVETQITPLGGFLLPATD
SKLHDKTCPPN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G265801 0 1
AT4G08850 Leucine-rich repeat receptor-l... Potri.019G129400 2.82 0.8339
AT1G35710 Protein kinase family protein ... Potri.019G129100 3.31 0.8405
AT1G68795 CLE12 CLAVATA3/ESR-RELATED 12 (.1) Potri.012G059600 5.19 0.7840
AT2G44260 Plant protein of unknown funct... Potri.009G025102 7.74 0.8098
AT2G28200 C2H2ZnF C2H2-type zinc finger family p... Potri.011G168900 15.49 0.7952
AT5G06570 alpha/beta-Hydrolases superfam... Potri.016G065000 15.49 0.7670
AT2G37730 Protein of unknown function (D... Potri.016G101200 16.00 0.7852
AT4G02590 bHLH bHLH059, UNE12 unfertilized embryo sac 12, ba... Potri.013G041000 19.89 0.7774
AT4G08850 Leucine-rich repeat receptor-l... Potri.019G129300 19.97 0.7943
AT4G27290 S-locus lectin protein kinase ... Potri.010G015400 22.36 0.7467

Potri.006G265801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.