Potri.006G266600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80450 61 / 7e-12 VQ motif-containing protein (.1)
AT5G08480 54 / 3e-09 VQ motif-containing protein (.1.2)
AT1G28280 51 / 4e-08 VQ motif-containing protein (.1.2)
AT5G53830 49 / 4e-07 VQ motif-containing protein (.1)
AT3G15300 46 / 2e-06 VQ motif-containing protein (.1)
AT2G33780 45 / 4e-06 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G266700 232 / 7e-79 AT1G80450 79 / 1e-18 VQ motif-containing protein (.1)
Potri.018G016500 166 / 1e-52 AT1G80450 67 / 6e-14 VQ motif-containing protein (.1)
Potri.011G118200 55 / 2e-09 AT1G28280 184 / 6e-58 VQ motif-containing protein (.1.2)
Potri.001G399100 54 / 6e-09 AT1G28280 190 / 2e-60 VQ motif-containing protein (.1.2)
Potri.004G134200 50 / 7e-08 AT5G08480 150 / 1e-46 VQ motif-containing protein (.1.2)
Potri.004G044800 44 / 2e-05 AT1G28280 223 / 1e-72 VQ motif-containing protein (.1.2)
Potri.011G053700 44 / 2e-05 AT1G28280 213 / 6e-69 VQ motif-containing protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026247 100 / 2e-26 AT1G80450 83 / 5e-20 VQ motif-containing protein (.1)
Lus10042423 96 / 6e-25 AT1G80450 83 / 6e-20 VQ motif-containing protein (.1)
Lus10020092 86 / 4e-21 AT1G80450 86 / 5e-21 VQ motif-containing protein (.1)
Lus10026897 60 / 3e-11 AT1G80450 67 / 4e-14 VQ motif-containing protein (.1)
Lus10015315 48 / 9e-07 AT1G28280 203 / 3e-65 VQ motif-containing protein (.1.2)
Lus10041929 44 / 3e-05 AT1G28280 155 / 7e-47 VQ motif-containing protein (.1.2)
Lus10005543 43 / 4e-05 AT5G53830 154 / 4e-46 VQ motif-containing protein (.1)
Lus10025443 40 / 0.0004 AT1G28280 154 / 2e-47 VQ motif-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.006G266600.1 pacid=42767010 polypeptide=Potri.006G266600.1.p locus=Potri.006G266600 ID=Potri.006G266600.1.v4.1 annot-version=v4.1
ATGAACACTCATACTTCCTCTTCTTCTTCTTCTTCACCTCTAACATCACCCACGACCTTTGTTCAGGCAGACATAAACACCTTCAGGGACCTTGTCCAAA
AACTAACCGGTTTAGCCAGTGACACGCAAAGACTCCCGGTGACAAGAACGCTCTCCTCCCCGAAACCATCACGTAACCCCGTTGACTTTACTGCTCCTCG
CCGGTCACCTTTCAAGCTCCAAGAGCGAAGACATACCTTAAGAAAGCTTGAGATCGAACTTGGCTTGATCTCTCTTAGTACCTCATCATCATCATCAACC
CTCCAAACACACCGACTGGACTCACCAGTGACTCCACTATGTTCAGGATTTTTGTTCTTCCCGAGCCCAGGAACTGAGTCACCATCGTCGCCAGCAGTTT
CAGAGGAGGAGAAGGCTATAGCTGAAAAGGGTTTTTACTTTCATCCTTCGCCTTTGAACACACCAAGAGGGAGCGAGCCACCTGAACTCCTAACTCTGTT
TCCATTGATTTCATCGAGCCAAAGTAATCAAGACTAG
AA sequence
>Potri.006G266600.1 pacid=42767010 polypeptide=Potri.006G266600.1.p locus=Potri.006G266600 ID=Potri.006G266600.1.v4.1 annot-version=v4.1
MNTHTSSSSSSSPLTSPTTFVQADINTFRDLVQKLTGLASDTQRLPVTRTLSSPKPSRNPVDFTAPRRSPFKLQERRHTLRKLEIELGLISLSTSSSSST
LQTHRLDSPVTPLCSGFLFFPSPGTESPSSPAVSEEEKAIAEKGFYFHPSPLNTPRGSEPPELLTLFPLISSSQSNQD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G80450 VQ motif-containing protein (.... Potri.006G266600 0 1
AT1G19860 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Potri.007G013600 3.16 0.7700
AT1G28280 VQ motif-containing protein (.... Potri.004G044800 11.74 0.7604
AT1G23710 Protein of unknown function (D... Potri.012G081000 15.49 0.7338
AT1G75950 UIP1, SKP1A, AT... UFO INTERACTING PROTEIN 1, ARA... Potri.001G132300 15.62 0.6531
AT1G28280 VQ motif-containing protein (.... Potri.011G053700 19.97 0.6227
AT5G11390 WIT1 WPP domain-interacting protein... Potri.017G106400 25.49 0.7084
AT4G06744 Leucine-rich repeat (LRR) fami... Potri.014G024300 44.54 0.6980
Potri.005G040650 44.82 0.7263
AT4G21350 PUB8, B80 plant U-box 8 (.1) Potri.004G028800 50.95 0.7129
AT3G57120 Protein kinase superfamily pro... Potri.008G037501 53.56 0.6931

Potri.006G266600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.