Potri.006G266700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80450 79 / 1e-18 VQ motif-containing protein (.1)
AT5G08480 63 / 1e-12 VQ motif-containing protein (.1.2)
AT5G53830 62 / 1e-11 VQ motif-containing protein (.1)
AT1G28280 61 / 2e-11 VQ motif-containing protein (.1.2)
AT2G33780 59 / 8e-11 VQ motif-containing protein (.1)
AT3G15300 58 / 2e-10 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G266600 271 / 5e-94 AT1G80450 61 / 6e-12 VQ motif-containing protein (.1)
Potri.018G016500 221 / 3e-74 AT1G80450 67 / 6e-14 VQ motif-containing protein (.1)
Potri.011G118200 70 / 6e-15 AT1G28280 184 / 6e-58 VQ motif-containing protein (.1.2)
Potri.001G399100 69 / 2e-14 AT1G28280 190 / 2e-60 VQ motif-containing protein (.1.2)
Potri.004G134200 68 / 2e-14 AT5G08480 150 / 1e-46 VQ motif-containing protein (.1.2)
Potri.004G044800 57 / 7e-10 AT1G28280 223 / 1e-72 VQ motif-containing protein (.1.2)
Potri.011G053700 50 / 2e-07 AT1G28280 213 / 6e-69 VQ motif-containing protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026247 129 / 1e-37 AT1G80450 83 / 5e-20 VQ motif-containing protein (.1)
Lus10042423 122 / 3e-35 AT1G80450 83 / 6e-20 VQ motif-containing protein (.1)
Lus10020092 109 / 3e-30 AT1G80450 86 / 5e-21 VQ motif-containing protein (.1)
Lus10026897 85 / 1e-20 AT1G80450 67 / 4e-14 VQ motif-containing protein (.1)
Lus10015315 55 / 3e-09 AT1G28280 203 / 3e-65 VQ motif-containing protein (.1.2)
Lus10025443 49 / 3e-07 AT1G28280 154 / 2e-47 VQ motif-containing protein (.1.2)
Lus10041929 46 / 3e-06 AT1G28280 155 / 7e-47 VQ motif-containing protein (.1.2)
Lus10005543 46 / 4e-06 AT5G53830 154 / 4e-46 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.006G266700.2 pacid=42769924 polypeptide=Potri.006G266700.2.p locus=Potri.006G266700 ID=Potri.006G266700.2.v4.1 annot-version=v4.1
ATGAACACTAATACTTCCTCTTCTTCTTCTTCTTCACCTCTAACATCACCCACGACCTTTGTTCAGGCGGACATAAACACCTTCAGGGACCTTGTCCAAA
AACTAACCGGTTTAGCCAGTGACACGCAAAGACTCCCGGTGACAAGAGCACTCTCCTCCGCGAAACCATCACGTAATCCCGTTGACTTAACTGGTCCTCG
CCGGTCACCTTTCAAGCTCCAAGAGCGAAGACATACCTTAAGAAAGCTTGAGATCAAACTTGGCTTGACCTCTCTTAGTAACTCATCATCATCACCAACC
CGCCAAACACACCGACTGGACTCACCAGTGACTCCACTTTGTTCAGGATTTTTGTTCTTCCCGAGCCCAGGAACCGAGTCACCATCGTCGCCAGCAGTTT
TAGAGGAGGAGAAGGCTATAGCTGAAAAGGGTTTTTACTTTCATCCTTCACCTTTGAACACACCAAGAGGGAGCGAGCCACCGGAGCTACTGACTCTGTT
TCCATTGAGTTCACCGAGCCAAAGTAATCAAGATTAG
AA sequence
>Potri.006G266700.2 pacid=42769924 polypeptide=Potri.006G266700.2.p locus=Potri.006G266700 ID=Potri.006G266700.2.v4.1 annot-version=v4.1
MNTNTSSSSSSSPLTSPTTFVQADINTFRDLVQKLTGLASDTQRLPVTRALSSAKPSRNPVDLTGPRRSPFKLQERRHTLRKLEIKLGLTSLSNSSSSPT
RQTHRLDSPVTPLCSGFLFFPSPGTESPSSPAVLEEEKAIAEKGFYFHPSPLNTPRGSEPPELLTLFPLSSPSQSNQD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G80450 VQ motif-containing protein (.... Potri.006G266700 0 1
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Potri.001G330501 4.12 0.7602
AT4G13730 Ypt/Rab-GAP domain of gyp1p su... Potri.001G316700 6.32 0.7325
AT4G01250 WRKY ATWRKY22, WRKY2... WRKY family transcription fact... Potri.014G090300 11.22 0.7104 Pt-WRKY22.2
AT2G01670 ATNUDT17 nudix hydrolase homolog 17 (.1... Potri.010G107300 15.00 0.7154
AT5G58190 ECT10 evolutionarily conserved C-ter... Potri.006G079900 19.44 0.6952
AT5G18150 Methyltransferase-related prot... Potri.013G058200 24.49 0.6741
AT2G14860 Peroxisomal membrane 22 kDa (M... Potri.001G296400 28.33 0.6898
AT5G52380 VASCULAR-RELATED NAC-DOMAIN 6 ... Potri.015G144600 28.56 0.7029
AT5G53110 RING/U-box superfamily protein... Potri.012G011500 31.52 0.6816
AT1G22640 MYB AtMYB3 ARABIDOPSIS THALIANA MYB DOMA... Potri.019G081500 36.57 0.7153 MYB6.2,MYB168

Potri.006G266700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.