Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57685 83 / 2e-20 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) AT4G31730 80 / 4e-19 ATGDU1, GDU1 glutamine dumper 1 (.1) AT4G25760 77 / 2e-18 ATGDU2 glutamine dumper 2 (.1) AT2G24762 76 / 1e-17 ATGDU4 glutamine dumper 4 (.1) AT5G24920 75 / 2e-17 ATGDU5 glutamine dumper 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G013600 [exp] 199 / 1e-65 AT4G25760 79 / 2e-19 glutamine dumper 2 (.1) Potri.006G173901 [exp] 94 / 1e-24 AT5G57685 89 / 8e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Potri.004G108800 [exp] 49 / 5e-08 AT5G24920 57 / 2e-11 glutamine dumper 5 (.1) Potri.017G107400 [exp] 40 / 9e-05 AT4G31730 76 / 1e-18 glutamine dumper 1 (.1) Potri.017G107100 [exp] 39 / 0.0002 AT5G24920 48 / 2e-08 glutamine dumper 5 (.1) Potri.017G107300 [exp] 38 / 0.0007 AT4G25760 75 / 1e-18 glutamine dumper 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026911 [exp] 112 / 2e-31 AT4G31730 125 / 6e-37 glutamine dumper 1 (.1) Lus10020107 [exp] 101 / 3e-27 AT4G31730 122 / 1e-35 glutamine dumper 1 (.1) Lus10006986 [exp] 96 / 6e-25 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10008910 [exp] 94 / 4e-24 AT5G57685 125 / 6e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10006987 [exp] 86 / 3e-21 AT5G57685 125 / 2e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10019986 [exp] 77 / 1e-17 AT5G57685 125 / 7e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10019985 [exp] 76 / 1e-17 AT5G57685 123 / 3e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10015513 [exp] 71 / 1e-15 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1) Lus10008909 [exp] 43 / 6e-06 AT5G57685 87 / 2e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G267900.1 pacid=42768789 polypeptide=Potri.006G267900.1.p locus=Potri.006G267900 ID=Potri.006G267900.1.v4.1 annot-version=v4.1 ATGAGACCCGTAAGCCACCTGGGCACCACCATGAGCTCATCAAAGGCAGCAGCCACTCCACCAGCAATAGCCCAACCTCGCTCACCATGGCACTCTCCTG TGCCTTACCTCTTTGGAGGTCTAGCAGCTATGCTGGGCTTGATTGCTTTTGCTTTATTAATCTTGGCTTGCTCTTATTGGAGATTGTCTAGTCGTTTAGA CAGTGAAAATGAAGGTAACGATCAAAGAGATCTTGAAAGTGGAAATGAAAAGGAAGGAAGTAACCCTGGGAAGGCAGAGAAAAGGGTTTATGAAGAGAAG TTCTTGGTTATTATGGCTGGGAATCAGAAGCCAACATTTTTAGCCACTCCTGTTTGTAGTAAAGTTTCTTCCTCTGGAGCCCAGATTGATAACCAAGAAG AAGAGAAGACAGAGAGCACCGGTGATCATTACAAGCTGAAAAATGAAGAAATGATAGGGGACAGCCATGATCAAGCAAGAACAACAGCTGAAGAAAACAT AGAGACACAAGAGAATCAACAAGAAGAACAAAATTAA
AA sequence Show only first row Show all	>Potri.006G267900.1 pacid=42768789 polypeptide=Potri.006G267900.1.p locus=Potri.006G267900 ID=Potri.006G267900.1.v4.1 annot-version=v4.1 MRPVSHLGTTMSSSKAAATPPAIAQPRSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWRLSSRLDSENEGNDQRDLESGNEKEGSNPGKAEKRVYEEK FLVIMAGNQKPTFLATPVCSKVSSSGAQIDNQEEEKTESTGDHYKLKNEEMIGDSHDQARTTAEENIETQENQQEEQN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G57685		LSB1, ATGDU3	LESS SUSCEPTIBLE TO BSCTV 1, A...		Potri.006G267900 [exp]	0	1
AT2G39490			F-box family protein (.1)		Potri.008G050800 [exp]	3.00	0.8245
AT5G10180		SULTR2;1, AST68	sulfate transporter 2;1, ARABI...		Potri.007G088700 [exp]	4.00	0.8027
AT1G76990		ACR3	ACT domain repeat 3 (.1.2.3.4....		Potri.005G185600 [exp]	10.58	0.7909	Pt-ACR3.2
AT3G12970			unknown protein		Potri.005G098300 [exp]	11.74	0.8015
AT1G62400		HT1	high leaf temperature 1, Prote...		Potri.011G022800 [exp]	11.74	0.7835
AT1G49230			RING/U-box superfamily protein...		Potri.019G010600 [exp]	11.83	0.7262
AT1G53440			Leucine-rich repeat transmembr...		Potri.006G014232 [exp]	19.10	0.7864
AT4G09760			Protein kinase superfamily pro...		Potri.002G063700 [exp]	19.33	0.7471
AT1G17860			Kunitz family trypsin and prot...		Potri.017G153200 [exp]	22.13	0.6875	Pt-ACTI.2
AT4G31980			unknown protein		Potri.003G209000 [exp]	25.78	0.7812

Compare expression of checked genes

Potri.006G267900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.